KEGG   Naumovozyma castellii: NCAS_0B04770Help
Entry
NCAS_0B04770      CDS       T02233                                 

Gene name
NCAS0B04770
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCAS_0B04770 (NCAS0B04770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(868397..869605)
Genome map
AA seq 402 aa AA seqDB search
MDLSNFKPEVWTTSSNSALKVSLVGKDGAVQFTPTFTYPIFGESEQIFGYKDLTIHLAFD
SVTFKPFVNVKYSSKLDTDETEDVEKKLLDVLPKDDDVIVKDEVKWVDSFEAEQSGGYSL
PPDKYEIEEYEIDGENYAVFKTNLTKSKDLKKLHRRVQIFSLLFIEAASYIDEDDSNWDV
FWLFNKTTKQCIGYVTAYMYWNYANASQFDRDNYTKHFRGKISQFLIFPPYQGKGHGSKL
YQAIFSHWLNATNVIELTVEDPNESFDDLRDRNDLEFLKKQGFFAEFSDDSNDFVEDNWL
VEKQLKYKLEKRQFSRLVEMILFSKGFTGLFRRQVKKRIFLKNYDALCDLEEAERKSALQ
NSYLLIKDDYKRILSSCSFNKRKLDDDEDPTNSDNKKVKFTE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggatctaagtaactttaaacctgaagtatggactacttcgtcaaacagtgcattgaaa
gtatcgctggttggtaaggatggtgcagttcaattcacacctactttcacatatcccata
tttggtgaatctgaacaaatttttggatataaagatttaactatccatttagcatttgat
tctgtgacttttaaaccttttgtaaatgtcaagtattcatcgaagttagatacagatgaa
actgaggatgttgaaaagaagttattggatgttttaccaaaggatgatgatgttattgtg
aaggatgaagtcaaatgggttgattcctttgaagcggagcaatctggaggatatagtctt
ccgcctgacaaatacgaaatagaagaatacgaaattgatggtgaaaattatgctgtattt
aaaacaaacttaacaaaaagcaaagatctcaagaaacttcatcgtcgtgtccagatcttc
tcacttctatttattgaagctgcttcctatattgatgaagacgattcaaattgggatgta
ttttggctatttaataaaactacaaagcaatgcattggttatgtcacagcatatatgtat
tggaactatgccaatgctagtcaatttgatagagacaactatacaaaacatttccgaggt
aaaatttcacaattcttaattttccccccatatcaaggtaaaggtcatggttcaaaacta
taccaagcaatttttagtcattggttgaacgctacaaatgtgatagaattgactgtagaa
gatcctaatgaaagcttcgatgacttgagagaccgtaacgacctcgagtttttaaagaag
caaggcttctttgctgagttttctgatgattctaacgacttcgttgaggacaattggctt
gtagaaaaacaactgaagtacaaacttgaaaagagacaatttagtagattggttgaaatg
atattattttctaaaggtttcactggactctttaggcgtcaagttaaaaagagaatattc
ttaaaaaattatgatgccctctgtgatcttgaagaggcagagaggaaaagtgctctccaa
aattcgtatttattgattaaagatgattacaaaaggatcttatccagctgttcgttcaac
aagcgcaagttggatgacgatgaagatcctactaattcagataataagaaggtcaagttt
acagaataa

DBGET integrated database retrieval system