KEGG   Naumovozyma castellii: NCAS_0B05560Help
Entry
NCAS_0B05560      CDS       T02233                                 

Gene name
NCAS0B05560
Definition
(RefSeq) hypothetical protein
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ncs  Naumovozyma castellii
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCAS_0B05560 (NCAS0B05560)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    NCAS_0B05560 (NCAS0B05560)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCAS_0B05560 (NCAS0B05560)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NCAS_0B05560 (NCAS0B05560)
Chromosome [BR:ncs03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     NCAS_0B05560 (NCAS0B05560)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCAS_0B05560 (NCAS0B05560)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1050313..1051371)
Genome map
AA seq 352 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNLTDDHIQYFIYQ
TLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMT
EYVATRWYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIG
TPSGRDLLCIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAE
EALAHPYLKTYHDPNDEPTGEPIPKSFFEFDSYKDVLTTKDLKKLLWNEIFG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaaatcgttttcaatatttccagtgatttccaattaaaatcccttcttggg
gaaggtgcttatggggttgtttgttcagctgttcataaacctacgggggagattgttgcc
atcaagaagattgaaccattcgacaaaccattatttgcattacgaacattaagagagatt
aagatcttgaaacatttccagcatgaaaatatcatttccattttcgacattcaaagacct
gaatcctttgagaattttaatgaagtgtacattatacaagagttgatgcagacagatttg
catcgtgtgatatcgacacagaatcttactgatgaccatatacaatatttcatatatcag
acgttgagagcggtgaaagtgttacacggatctaatgtcattcatcgagatttgaaacca
tccaaccttttaataaattccaactgtgatttaaagatctgtgattttggattagcaaga
attattgaagaggacactggtgatgatgaacccaacgcacaattacaaaacggtatgacg
gaatatgtggctaccagatggtatcgtgcaccagaggtgatgctaactgctgccagatat
tccaaggcaatggacatatggtcctgtggttgtattctggctgagttattcatgaagagg
cccatattcccggggaaggattaccgtcatcaactaatgttaatattcggtcttattggg
acgcctagtgggagagatctattgtgcattgaatcaagaagagcaagagagtatattacc
acgctacccaaatacgagcctgtcccctgggagaaggttttccccaatgttaacccactg
ggaattgatcttttacaaagaatgcttattttcgacccacgtagcagaatcacagcagag
gaagcattagcgcatccatatttgaagacgtatcatgaccctaatgacgagcccacgggt
gaacctatcccgaagtcctttttcgagtttgattcctacaaggatgtgctgacgacaaag
gacctgaagaagttgctgtggaacgaaatcttcggttag

DBGET integrated database retrieval system