KEGG   Naumovozyma castellii: NCAS_0B05560Help
Entry
NCAS_0B05560      CDS       T02233                                 

Gene name
NCAS0B05560
Definition
(RefSeq) hypothetical protein
Organism
ncs  Naumovozyma castellii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1050313..1051371)
Genome map
AA seq 352 aa AA seqDB search
MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQNLTDDHIQYFIYQ
TLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIIEEDTGDDEPNAQLQNGMT
EYVATRWYRAPEVMLTAARYSKAMDIWSCGCILAELFMKRPIFPGKDYRHQLMLIFGLIG
TPSGRDLLCIESRRAREYITTLPKYEPVPWEKVFPNVNPLGIDLLQRMLIFDPRSRITAE
EALAHPYLKTYHDPNDEPTGEPIPKSFFEFDSYKDVLTTKDLKKLLWNEIFG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaaatcgttttcaatatttccagtgatttccaattaaaatcccttcttggg
gaaggtgcttatggggttgtttgttcagctgttcataaacctacgggggagattgttgcc
atcaagaagattgaaccattcgacaaaccattatttgcattacgaacattaagagagatt
aagatcttgaaacatttccagcatgaaaatatcatttccattttcgacattcaaagacct
gaatcctttgagaattttaatgaagtgtacattatacaagagttgatgcagacagatttg
catcgtgtgatatcgacacagaatcttactgatgaccatatacaatatttcatatatcag
acgttgagagcggtgaaagtgttacacggatctaatgtcattcatcgagatttgaaacca
tccaaccttttaataaattccaactgtgatttaaagatctgtgattttggattagcaaga
attattgaagaggacactggtgatgatgaacccaacgcacaattacaaaacggtatgacg
gaatatgtggctaccagatggtatcgtgcaccagaggtgatgctaactgctgccagatat
tccaaggcaatggacatatggtcctgtggttgtattctggctgagttattcatgaagagg
cccatattcccggggaaggattaccgtcatcaactaatgttaatattcggtcttattggg
acgcctagtgggagagatctattgtgcattgaatcaagaagagcaagagagtatattacc
acgctacccaaatacgagcctgtcccctgggagaaggttttccccaatgttaacccactg
ggaattgatcttttacaaagaatgcttattttcgacccacgtagcagaatcacagcagag
gaagcattagcgcatccatatttgaagacgtatcatgaccctaatgacgagcccacgggt
gaacctatcccgaagtcctttttcgagtttgattcctacaaggatgtgctgacgacaaag
gacctgaagaagttgctgtggaacgaaatcttcggttag

DBGET integrated database retrieval system