KEGG   Naumovozyma castellii: NCAS_0B08220Help
Entry
NCAS_0B08220      CDS       T02233                                 

Gene name
NCAS0B08220
Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NCAS_0B08220 (NCAS0B08220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1564801..1565886)
Genome map
AA seq 361 aa AA seqDB search
MSAAAAASRTFLPVFSNTFKRRSLYLFTASATAATAAAAISHQRSKHHQYQNPRNNNNNR
GVWGALAAAAPIVHLASAPAGKTKEDYQKVYNAIAEKIREEDEYDNYIGYGPVLVRLSWH
VSGTFDKGDNSGGSYAGTYRFKQEETDPSNKGTENAGRFLDSIFKEFPWMSHGDMYTLAG
VTAVQEMQGPKIPWRPGRVDLPESAYPGQGRLPDAGQGANYMRHFFDRFGFNDREVVALL
GAHALGKTHLKNSGYEGPWGAANNTFTNEFFMNLLNEDWKLEKNDAGNMQWNSSKGYMML
PADMALVQDPNYLKIVKEYANDLDLFFKDYTNAYVKLLENGITFPKDSKPFIFKTLDEQD
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctgctgccgcctccagaacattcctcccagtgttctccaacacattcaag
aggagatccctatatctcttcactgcttccgccacggccgccaccgctgccgccgccatc
tcccaccagagatccaagcaccaccaataccagaaccctcgtaacaataacaacaacagg
ggtgtttggggtgcccttgctgctgccgctcccatagtccacttggcctccgcccccgcc
gggaagaccaaggaagactaccagaaggtctacaacgccattgctgaaaagatcagagaa
gaggacgaatacgataactatattggatacggtcccgttcttgtgcgtctctcatggcat
gtgtctgggaccttcgacaagggagataactccggggggtcctatgctgggacttaccgt
ttcaagcaagaagagacagatccttctaataagggaactgagaacgctggaagattcttg
gattctatctttaaggaattcccatggatgtctcatggtgacatgtacactttggccggt
gtcactgccgtccaggagatgcagggaccaaagatcccttggagaccaggtagagtcgac
ttaccagagtctgcatacccgggtcaaggtagattaccagatgctggacaaggtgctaat
tatatgagacacttcttcgatagatttggatttaatgatagagaggtcgtggctctattg
ggggctcatgctttggggaagactcatttgaagaattcaggttatgaaggtccatggggg
gccgctaataacacttttactaatgaattctttatgaatttgttgaacgaagattggaaa
ttggagaagaacgacgcaggaaacatgcaatggaactcgtctaaggggtacatgatgttg
cccgctgatatggctttggtgcaagatccaaattatttgaagatcgtcaaggaatatgct
aatgatttggatttgttcttcaaagattacactaatgcttatgtcaaattgttggagaat
gggattactttccccaaggacagtaaaccattcatcttcaagaccttggatgaacaagat
ctctga

DBGET integrated database retrieval system