KEGG   Naumovozyma castellii: NCAS_0B08520Help
Entry
NCAS_0B08520      CDS       T02233                                 

Gene name
NCAS0B08520
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ncs  Naumovozyma castellii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCAS_0B08520 (NCAS0B08520)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NCAS_0B08520 (NCAS0B08520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1634337..1635356
Genome map
AA seq 339 aa AA seqDB search
MGITVVGSLNYDLVTYTDRIPGPGETFRANRFETHAGGKGLNQTIATARMRDDDYNYPVR
MVGNVGDDSFGEQLIKILRDNDVDVSQVGSLPGVETGVATIIVEEKEGQNRIIITAGANG
KTTFTNEQLNRIFPEISGQEKEVVVFQQEIPNPASVVHWLHENRSSHEIVFNPSPFQPLD
EKDWELIDVLVVNEIEALQIVKTIYDEEQIKYYEERIAGDFVKGYEMICQEFQKNLVNQR
KSAIVIITLGSKGALFCSKNHLKVGYVPAAKVKSVVDTTGAGDTFLGSIVTQLYQNQPLE
SAMTFSTKASSLAIQKRGAAESIPRFNDVLFSLQVKEKH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggtattaccgtggtaggttcattaaattacgatctggtcacttatacagatagaatt
ccaggtcccggagaaacgtttagagcaaataggttcgagactcatgccggagggaaagga
ctaaaccagactattgctactgctagaatgagggatgatgattacaactatcctgtaagg
atggttgggaatgtcggtgacgattcttttggagaacaattaattaaaatcttaagggat
aatgatgttgacgtttcgcaagtcggctcattacctggggttgaaaccggtgtagcaaca
attattgtagaggaaaaagagggtcagaataggatcatcattacggcaggtgctaatggt
aaaacaacttttacaaatgagcaattgaatagaatttttcctgaaatttctggtcaagag
aaggaagttgttgtttttcaacaagaaatcccaaatccagcatcagtagttcattggctg
catgaaaatcgatcaagtcatgaaattgtgtttaacccatcaccatttcaaccattagac
gaaaaggattgggagcttatcgatgttttagtagttaatgaaattgaagcacttcaaatt
gtgaaaactatatatgatgaagaacagatcaaatattatgaagaacgtatcgctggcgat
ttcgttaaaggttatgaaatgatttgtcaagagttccaaaaaaaccttgttaatcaacgt
aaatctgcaattgtcattattacattgggttccaaaggtgccctcttttgttcaaagaac
catctaaaggttggatatgttccagcagcaaaagtaaaaagtgtagttgatactaccggt
gctggtgatacgtttttaggatcaatcgtcactcaactctatcaaaatcaaccactggaa
tctgcgatgacgttttcaacaaaagcaagttctttagccatacaaaagagaggtgctgct
gaaagtattccaagattcaatgatgttttattttcattgcaagtcaaggagaagcattga

DBGET integrated database retrieval system