KEGG   Naumovozyma castellii: NCAS_0B08940Help
Entry
NCAS_0B08940      CDS       T02233                                 

Gene name
NCAS0B08940
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ncs  Naumovozyma castellii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NCAS_0B08940 (NCAS0B08940)
Enzymes [BR:ncs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NCAS_0B08940 (NCAS0B08940)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCAS_0B08940 (NCAS0B08940)
  Exosomal proteins of colorectal cancer cells
   NCAS_0B08940 (NCAS0B08940)
  Exosomal proteins of bladder cancer cells
   NCAS_0B08940 (NCAS0B08940)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1718190..1719794
Genome map
AA seq 534 aa AA seqDB search
MLLNKKTLFSVATVLSSALSAHAQQAQQAAQEATAPADSAVVKLTTDNFEEFIKENPLVL
AEFFAPWCGHCKHLAPEYIKAASELEDKNIPLAQIDCTEDQELCMKMDIPGYPTLKVFKN
HDLANPKDYQGARTADSIISFMVKQSLPDVTVVSTEDQLTDLLTNATEPIVVDSGLPGLN
KSFYQIAGRLSSEYIFLSYTAENSSTSSSSLALYLPNEQDPIIFNGDAKKLSADPEELVK
WLKVEALPYFGDIDGSVFNQYMDSGLPLAYFFYTTEEEREQYTDYFTELAKKHRGELNFV
GIDSRKFGRHAENLNMKEQFPLFAIHDMDKNLKYGLPQLAKEEFEKLKTAAKVETKEITK
LVDNFLSGKAKAIVKSEPVPTVQESNVYKLVGTTHDKIVFDKKKDVLVKYYAPWCGHCKK
LAPIYEELADIYASDKNANKKVLIAEVDATENDIANLNIEGYPTIILYPAGKNAEPVTFT
SARSLEGFLGFMKAKGANKVDGESLYKTYLATKKAAEPEDEIDDDDLDLDHDEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgttattgaacaagaaaactttattttctgttgctaccgtgctaagcagtgctttatct
gctcatgctcaacaagctcaacaagccgctcaagaagctaccgcacctgctgattccgct
gtcgttaaattaactaccgataattttgaagagttcatcaaggaaaatccattagtccta
gctgaattctttgccccatggtgtggtcactgtaaacatttggctccagaatatattaag
gctgcctccgaattggaagataaaaatatcccattagctcaaatcgattgtactgaagat
caagaactttgtatgaagatggatatcccaggttatccaactttgaaagtcttcaagaac
cacgatttggctaatccaaaggattatcaaggtgcaagaaccgctgactccatcatttca
ttcatggtaaagcaatctctacctgatgtcacagtcgtatccactgaagatcaattaact
gatttattaacaaacgctacagaacctatcgtcgtcgactcaggtctaccaggtttaaat
aaatccttctatcaaatcgctggtcgtttatcttcagaatatattttcttatcatacaca
gctgaaaattcatcaacatcatcatcatcattagcattatacttaccaaatgaacaagat
ccaatcatcttcaacggggacgccaagaaattgagcgccgatccagaagaattggtcaaa
tggttgaaagtggaagctttaccttatttcggtgacattgatggctccgtctttaatcaa
tatatggatagtggattaccattagcttatttcttttacaccaccgaggaggaaagagaa
caatatactgattatttcactgaattagccaagaaacatcgtggtgaattgaatttcgtc
ggtattgattcaagaaaattcggtagacatgctgaaaatttgaacatgaaggaacaattc
ccattatttgccattcatgatatggataagaatttgaaatatgggttacctcaattagca
aaggaagaatttgaaaaattaaagactgctgctaaggtggaaacaaaggaaattactaaa
ttagtcgataatttcttatctggtaaggctaaggctattgtcaaatccgaacctgtccca
accgtgcaagaatctaacgtttacaaattggtcggtaccactcatgacaagattgtcttc
gataagaagaaggatgtcctagttaagtattatgctccatggtgtggtcactgtaagaag
ttggctccaatctacgaagaattagctgacatttatgcatctgataagaatgctaacaag
aaggtccttattgctgaagtggatgccactgaaaatgatattgctaatttgaatattgaa
ggttatccaacaattatcttatacccagctggtaagaacgctgaacctgtcactttcaca
tctgctagatctttagaaggtttcctaggattcatgaaggcaaagggtgccaacaaggtc
gatggtgaatctctttataagacttatttagccacaaagaaggctgctgaaccagaagat
gaaattgatgatgacgatttagatttagatcatgatgaattgtaa

DBGET integrated database retrieval system