KEGG   Naumovozyma castellii: NCAS_0C01390Help
Entry
NCAS_0C01390      CDS       T02233                                 

Gene name
NCAS0C01390
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ncs  Naumovozyma castellii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NCAS_0C01390 (NCAS0C01390)
  Replication and repair
   03420 Nucleotide excision repair
    NCAS_0C01390 (NCAS0C01390)
Transcription machinery [BR:ncs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NCAS_0C01390 (NCAS0C01390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:254415..255965
Genome map
AA seq 516 aa AA seqDB search
MSTSVLKNSVTQYLEEIPQQVQTRLYESPATCLAIYRLLPQLAKFFVMSMVFNDKEVSLR
DLDRWVKSNGKMQFQDAIKSMKSLHLIIPSKSNGGPLMINLNPTFRESFKNALTGGQVDN
SFGIVADDDDDNGVVSLQLLDEYSANKWETILHFMVGTPMSSIPSASVLNLLKHTRLMEE
VDHTSEFKITNEGFQFLLQELNSQIWTLLLQYLKMSETLKMDSVDVLNFIFMLGALEVGK
GYSIDGLSETQKIMLKDMRDYGLVFQKYTNSNLFYPTNLALMLTSDTKSIVRTASGALES
VLQNKREDSSKQANGEINKDLITNGDELDQVGYNPQDIPDGSLIIETNFKLYSYSNSPLQ
IATLSLFVHLKSRFANMVTGQITRESIRRALINGITADQIIAYLETHAHPQMRRLAEERL
EKKLELDPNSKDPLQVLPPTVVDQIKLWQLELDRVITYEGSLYSDFETIAEYTTLSKYAQ
DIGVLLWKDDKKKKFFVSKEGNSQVLDYAKRKLKKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccagtgtattgaagaattcggttacccaatacttggaggaaattccacaacag
gtgcaaactagactttatgaatcaccagcaacgtgtttggccatttatagattactgcct
caactagctaaatttttcgtcatgtctatggttttcaatgataaagaagtctctttacgt
gatttagatagatgggtgaagtctaatgggaaaatgcaattccaagatgctatcaaatcc
atgaaatcattacatttgatcataccttcgaaaagtaacggaggtcccttaatgattaac
ttaaatccaacattcagggagagctttaagaacgcattgacaggtggtcaggtggataat
tcatttggtatagtagcagatgatgacgatgataatggagttgtttcattacaattattg
gatgagtattctgcaaataaatgggagacaattttacattttatggtggggactcccatg
tcaagcataccatcggcaagtgttttaaacctattgaaacatacaagactgatggaagaa
gtagatcatactagtgaattcaaaattaccaatgaagggtttcaattcctgttacaagaa
ttgaactctcaaatttggactttattattgcagtatttgaaaatgtctgaaacgttaaag
atggattctgtggatgttttgaactttatttttatgttaggtgcattagaagttgggaag
gggtacagcatagatggtctaagtgaaacgcaaaagataatgttgaaagatatgagagat
tatgggctggttttccaaaaatatacaaattcgaatttattctatcctaccaatttggct
ttgatgctaacatcagacactaagagtatagtgagaaccgcgtctggtgcactggagagt
gttttacaaaacaagagagaagacagtagcaaacaagcaaacggtgaaattaataaagat
cttattaccaatggagatgaactagatcaagttggatacaacccacaggatataccagat
ggctctcttattatagaaactaattttaaattgtattcgtattccaattcgccattgcaa
atagctaccctgagtttattcgttcatttaaaatctagatttgcaaatatggtgacgggt
caaataacaagagaatccattagacgagcattgattaacggtattaccgcggaccaaatt
atagcgtacctggaaactcatgcacatccacagatgaggaggttggctgaagagagactg
gagaaaaagttagagctggacccaaactctaaggatccgttacaagtgctgcctccaact
gtggttgatcaaattaaactatggcaattagaattagatagagttatcacctatgaggga
tcgttgtattcagattttgaaactatcgctgaatataccacactcagtaaatatgcccag
gatatcggtgttctgctgtggaaagatgacaagaagaagaagttcttcgtttccaaggag
ggaaattcacaagtcttggattatgctaagagaaagctaaagaagaaataa

DBGET integrated database retrieval system