KEGG   Naumovozyma castellii: NCAS_0C01760Help
Entry
NCAS_0C01760      CDS       T02233                                 

Gene name
NCAS0C01760
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCAS_0C01760 (NCAS0C01760)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:324446..326548
Genome map
AA seq 700 aa AA seqDB search
MSQQDPLEKFYKQFQSFVQNNPNVISAARAASQIPESAKAVIVLSPYSLQHTFPREWVSK
SYRKTIVERPERLLASSMGIAAAITMYPALFTLKSSNQRMGSIMSPHVYKVHGKEWPKEV
IQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETGVDSIFKGPSADHI
SNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTYGVTHVAVLDFDLHHGDGTQD
LCWKRAGFKPDEDINPKEGEYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNA
STCLMNSHDLNIWNIHMSNWNNEEEFVKLYRSKYRVLFAKADEYFKTAKLEMAALGRPFK
GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSD
KAITSGVFAHLIGLQNQDWIKEWGSEHVIKEIVRGCKPAWKPYKTKRSKDVIRIWAEEVI
RLGRAMIPEFEDVLFKTAKIKTEVLDNGPTIAQRVTRQYARTHSPEREFSKTEVDAYQKR
SNDLKRKEHRQMQLGAVTASKAESVPFIQQDLSSGDEDEDEDYVYDEELNKTFNRTVEDI
SIDDISRHLETLEITQSEDMETPQEGSNRRHSQHRSHNVDQRQPRRLQSNGMYKIPSSTT
TQHLKSGRNSNVPTYEDSDISMVSHISTTRKHTTRSGARW
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaagaccccttagagaaattttataaacagtttcaatcatttgtccaaaat
aatccaaatgtcatctcagcagctcgtgcagcatcacaaatacctgaatcggcaaaggca
gtcatagttctttctccatactcacttcaacatactttccctagagaatgggtttccaaa
tcatataggaaaactattgtagagagaccagaacgtttattagcaagctccatggggatt
gcggctgctataaccatgtatcctgcgttatttacattgaaatcctcgaaccagagaatg
ggttccatcatgtcgcctcatgtttacaaagttcatgggaaggaatggccaaaagaggta
atccaattgtgtaaagaggcagatgaaaagctagcaaagggtgaaatagaagtgccagaa
tcatggaatgcaggtgatatctatttaagttccaagacaatccaagcattacaggggacc
attggtgcattagaaacaggggtggattctatctttaaaggtccctcagctgaccatata
agcaatagagcatttgtagctatacgaccaccgggacatcattgtcattttgctacacct
tcagggttttgcttgctaaataatgcacatgttgccatcgaatatgccgctgatacatac
ggcgtcacacatgtggctgtcttagattttgatctacatcatggtgatgggacacaagac
ctttgttggaaacgtgcaggttttaagccggatgaagatataaatccaaaggaaggtgaa
tatgatgattttgggaagaagtttgctgagttccctaaagttggatatttctcaatgcat
gacatcaattcgttcccaactgaatctgggtttgctaccaaggaaaatattaagaacgct
tctacatgtttaatgaactctcatgatctaaatatatggaatatccatatgtccaattgg
aataatgaggaagaatttgtgaagctatatcgatctaaatatagagtattatttgccaag
gcagatgaatacttcaaaacagctaaattagagatggcagctctaggaagacctttcaaa
gggatggtacttattagtgctggttttgatgcgtctgagtttgaacagacgactatgcaa
agacatggtagcaatgttcctactgagttttacacaatgtttactaaagatgcacttaaa
ttggcccaaatgcattgccaaggaaaggtactatcattaatggaaggtggttattctgac
aaggcaatcacgtctggtgtttttgcccacttgatcgggttacaaaaccaagattggatt
aaggaatggggatctgaacatgttataaaggaaatagttcgtgggtgcaagccagcatgg
aaaccatacaaaaccaagagatccaaagatgtaataagaatctgggcagaagaagtcata
cgattaggtagagcaatgatcccagaatttgaagatgtcctatttaagacggcaaagata
aaaacagaagtacttgacaacggacccactattgctcagagagttactaggcaatatgca
cgtacacactcaccagaaagggaattttccaagactgaagtagacgcatatcagaaaaga
tcaaatgatcttaagagaaaggaacatagacaaatgcaattaggtgccgtaactgcatct
aaagcggagagtgttccatttattcaacaggacttatcgagtggagatgaggatgaagat
gaagattatgtttatgacgaagaattaaataaaacttttaatcgtactgtggaagatatt
tccattgatgatatctccaggcatttggaaacattggaaatcactcaatcagaggatatg
gagacaccacaggaaggatcaaatagaagacactcgcaacatcgaagccataacgtagac
caacgtcaacctcgtcgtctacaaagcaatggaatgtataaaatcccatcaagtaccacc
acccagcatctaaagagtggccgaaattccaatgttcctacgtatgaagatagcgatata
tccatggtatctcatatatcgacgacaagaaaacatactactcgaagtggagctcggtgg
tag

DBGET integrated database retrieval system