KEGG   Naumovozyma castellii: NCAS_0C01810Help
Entry
NCAS_0C01810      CDS       T02233                                 

Gene name
NCAS0C01810
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCAS_0C01810 (NCAS0C01810)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCAS_0C01810 (NCAS0C01810)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NCAS_0C01810 (NCAS0C01810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:335214..336212
Genome map
AA seq 332 aa AA seqDB search
MTKITATTTIEPSYKHYPAKKLSIIAAPFSGGQSKLGVEKGPTFMLKHGLQHQLTNLGWT
TQVQHPFSQEDYSTRVKSDTKDMLAHIKRPQLVGEAAQLVYGAVQEALSHNEFPLTLGGD
HSIAMGTVSATVEKYPDVGVLWIDAHADINTLDSTDSGNLHGCPVSFLMGLNKTGKLECP
PSLQWVPANLKPEKIVYIGLRDIDATEKEILKEQGINAFSMYHVDKFGINKVIEMALMLL
HPETAGVGPIMCSYDVDALDPLFVPATGTPVRGGLTLREGLFLVERLAETGDLVGLDIVE
VNPDLAAHDVHVSDTIAASCAIARCALGETLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatcactgccacaacaacaatagaaccatcttacaagcactaccccgccaag
aaactatccatcatcgcagctcccttctccggaggccaatccaaactgggtgtcgagaag
ggccccactttcatgctcaagcacggtcttcaacatcaattaaccaatctcggatggacc
acccaggtgcagcacccattctctcaagaggactactccactcgagtgaaatcggacaca
aaggatatgttggcccatatcaagagaccacagttagtaggtgaagcagcacaattagtt
tacggagccgtccaggaggcattatctcacaatgaattcccgctaactttgggaggagat
cactcaatcgctatggggaccgtctccgctactgttgaaaaatatcccgacgttggtgtc
ctctggatcgacgctcacgctgatattaatacgttggactccacggattcaggtaatttg
cacggttgtcccgtgagtttcctcatggggttgaacaagacggggaaattggaatgtcca
ccctcgttacaatgggttcctgctaatttaaaaccagaaaagattgtatacataggtttg
agagatatcgatgctacagagaaggaaattttgaaagaacaggggatcaatgccttttcc
atgtatcatgtggataaattcggaattaacaaagtcattgagatggctttgatgttatta
cacccggaaactgccggggtgggacccattatgtgttcatatgacgtggatgcattggat
ccactgtttgttccagcaacagggaccccagtgagaggtgggttgactctaagggaggga
ttgttcttagtagaacgtctggctgaaactggggatttggtcggtttggatatcgtcgag
gttaatccagatttggctgctcatgacgtgcatgtctcagataccattgctgcaagttgc
gccattgcaaggtgtgcactaggtgaaactttgctataa

DBGET integrated database retrieval system