KEGG   Naumovozyma castellii: NCAS_0C01810Help
Entry
NCAS_0C01810      CDS       T02233                                 

Gene name
NCAS0C01810
Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00220  Arginine biosynthesis
ncs00330  Arginine and proline metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01230  Biosynthesis of amino acids
Module
ncs_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    NCAS_0C01810 (NCAS0C01810)
   00330 Arginine and proline metabolism
    NCAS_0C01810 (NCAS0C01810)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NCAS_0C01810 (NCAS0C01810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 11527832
NCBI-ProteinID: XP_003675537
UniProt: G0VCG1
Position
3:335214..336212
Genome map
AA seq 332 aa AA seqDB search
MTKITATTTIEPSYKHYPAKKLSIIAAPFSGGQSKLGVEKGPTFMLKHGLQHQLTNLGWT
TQVQHPFSQEDYSTRVKSDTKDMLAHIKRPQLVGEAAQLVYGAVQEALSHNEFPLTLGGD
HSIAMGTVSATVEKYPDVGVLWIDAHADINTLDSTDSGNLHGCPVSFLMGLNKTGKLECP
PSLQWVPANLKPEKIVYIGLRDIDATEKEILKEQGINAFSMYHVDKFGINKVIEMALMLL
HPETAGVGPIMCSYDVDALDPLFVPATGTPVRGGLTLREGLFLVERLAETGDLVGLDIVE
VNPDLAAHDVHVSDTIAASCAIARCALGETLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatcactgccacaacaacaatagaaccatcttacaagcactaccccgccaag
aaactatccatcatcgcagctcccttctccggaggccaatccaaactgggtgtcgagaag
ggccccactttcatgctcaagcacggtcttcaacatcaattaaccaatctcggatggacc
acccaggtgcagcacccattctctcaagaggactactccactcgagtgaaatcggacaca
aaggatatgttggcccatatcaagagaccacagttagtaggtgaagcagcacaattagtt
tacggagccgtccaggaggcattatctcacaatgaattcccgctaactttgggaggagat
cactcaatcgctatggggaccgtctccgctactgttgaaaaatatcccgacgttggtgtc
ctctggatcgacgctcacgctgatattaatacgttggactccacggattcaggtaatttg
cacggttgtcccgtgagtttcctcatggggttgaacaagacggggaaattggaatgtcca
ccctcgttacaatgggttcctgctaatttaaaaccagaaaagattgtatacataggtttg
agagatatcgatgctacagagaaggaaattttgaaagaacaggggatcaatgccttttcc
atgtatcatgtggataaattcggaattaacaaagtcattgagatggctttgatgttatta
cacccggaaactgccggggtgggacccattatgtgttcatatgacgtggatgcattggat
ccactgtttgttccagcaacagggaccccagtgagaggtgggttgactctaagggaggga
ttgttcttagtagaacgtctggctgaaactggggatttggtcggtttggatatcgtcgag
gttaatccagatttggctgctcatgacgtgcatgtctcagataccattgctgcaagttgc
gccattgcaaggtgtgcactaggtgaaactttgctataa

DBGET integrated database retrieval system