KEGG   Naumovozyma castellii: NCAS_0C02110Help
Entry
NCAS_0C02110      CDS       T02233                                 

Gene name
NCAS0C02110
Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:398702..400186
Genome map
AA seq 494 aa AA seqDB search
MPNNLYLSSLVDGNYNRTWLELFLQRKGQLLRKITYTALLGLSLYVISPTVVNYLLSVLG
LEKGSKGPKRLDKFTTGLVNPGNDCFINSSIQALVPLDKLTTYLSATLEDEKTASTLPLH
NGLATMLLELQQLRSDPKSVSSKRFIQQLETIFGGKISRQQNDAHEFTQLILERLNEENL
TLDHADLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQGSVKLSDLVNGEQME
TIENYSCMYCKTVAMLTNEREEKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHYI
NSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLP
RQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHYQCYRHKPTLLLEKVTGNIINGSPIIT
LNTLQSTVSTTSCSLENEERFQNLKEDKKKLKLLKSVKMNPYWWISDSSVKECKVSRVLD
EKKYVYMLYYERIH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacaatctttatttatcgtcattggtcgatggaaactataacagaacatggctc
gaactttttttgcagaggaagggccaacttttgcgtaaaataacatatacagcactactc
gggttgtcactctatgtcatttcgccaactgtagttaattatttactgtctgtgttaggt
ttggaaaagggatcgaaaggtccaaagagactggataaatttacaactggtttggtaaat
ccagggaatgattgctttatcaattcatccattcaagctctagtaccattagacaaacta
acaacatatttgagcgccactttagaagatgaaaagacagcgtcaactctaccattacat
aatggattagccacaatgttgcttgaattacaacaattacggtcagatcctaaaagtgtc
tcgtcgaaacggtttattcagcaactggaaaccatatttggtgggaaaatttcccgtcag
caaaacgatgctcatgagtttacacaattaattctagagagattgaatgaggaaaatttg
acacttgaccatgctgacttaacggttccatttaaggggattgttggtaatcatttagtt
tgtttacaatgtggtcgcacttcccatgttaatgagcagcctttctacatatatgaattg
acattacctcaacaaggatcagtcaaactttccgatttggtgaatggggaacaaatggaa
acaattgagaattattcctgtatgtattgtaaaacagtagccatgttaacgaatgaaaga
gaggaaaagtctaatgtttcacgcaccgatgcagaacttaatatcttgaagttcttgaag
ggaaaattgtcaaccttattaataaatgaagaattgcctgaacacataactcattatatt
aattcctacaacaagggttactgcaatacaagtgaaattaagtcggttattgttaggaag
tccacatttgctgaatttcctgaaatttttttaattcatttatcaagatcagtcttcaat
gggatgaactattcaaggaatccatgtcaagttgagtttgaagaagaaattttgttacca
agacaaatattgaaggaccaccaatgtgtagggtttgaaacggtcaaatataaacttaaa
tcaattgtaaagcacacaggctcacattatcaaggccactatcagtgttatagacacaaa
ccaacacttttattggagaaggtgacaggaaatatcatcaacggctctccaataataaca
cttaacactcttcaaagtactgtatcaacaaccagctgctctctggagaacgaagaacga
tttcaaaatttgaaggaagataagaagaaattgaaattactcaaaagtgtcaagatgaat
ccttactggtggatttcagattcatctgtaaaggaatgtaaggtctcaagggtgcttgat
gaaaagaaatatgtttacatgctttattatgaacgtatacattga

DBGET integrated database retrieval system