KEGG   Naumovozyma castellii: NCAS_0C02110Help
Entry
NCAS_0C02110      CDS       T02233                                 

Gene name
NCAS0C02110
Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCAS_0C02110 (NCAS0C02110)
Peptidases [BR:ncs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCAS_0C02110 (NCAS0C02110)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:398702..400186
Genome map
AA seq 494 aa AA seqDB search
MPNNLYLSSLVDGNYNRTWLELFLQRKGQLLRKITYTALLGLSLYVISPTVVNYLLSVLG
LEKGSKGPKRLDKFTTGLVNPGNDCFINSSIQALVPLDKLTTYLSATLEDEKTASTLPLH
NGLATMLLELQQLRSDPKSVSSKRFIQQLETIFGGKISRQQNDAHEFTQLILERLNEENL
TLDHADLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQGSVKLSDLVNGEQME
TIENYSCMYCKTVAMLTNEREEKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHYI
NSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLP
RQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHYQCYRHKPTLLLEKVTGNIINGSPIIT
LNTLQSTVSTTSCSLENEERFQNLKEDKKKLKLLKSVKMNPYWWISDSSVKECKVSRVLD
EKKYVYMLYYERIH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacaatctttatttatcgtcattggtcgatggaaactataacagaacatggctc
gaactttttttgcagaggaagggccaacttttgcgtaaaataacatatacagcactactc
gggttgtcactctatgtcatttcgccaactgtagttaattatttactgtctgtgttaggt
ttggaaaagggatcgaaaggtccaaagagactggataaatttacaactggtttggtaaat
ccagggaatgattgctttatcaattcatccattcaagctctagtaccattagacaaacta
acaacatatttgagcgccactttagaagatgaaaagacagcgtcaactctaccattacat
aatggattagccacaatgttgcttgaattacaacaattacggtcagatcctaaaagtgtc
tcgtcgaaacggtttattcagcaactggaaaccatatttggtgggaaaatttcccgtcag
caaaacgatgctcatgagtttacacaattaattctagagagattgaatgaggaaaatttg
acacttgaccatgctgacttaacggttccatttaaggggattgttggtaatcatttagtt
tgtttacaatgtggtcgcacttcccatgttaatgagcagcctttctacatatatgaattg
acattacctcaacaaggatcagtcaaactttccgatttggtgaatggggaacaaatggaa
acaattgagaattattcctgtatgtattgtaaaacagtagccatgttaacgaatgaaaga
gaggaaaagtctaatgtttcacgcaccgatgcagaacttaatatcttgaagttcttgaag
ggaaaattgtcaaccttattaataaatgaagaattgcctgaacacataactcattatatt
aattcctacaacaagggttactgcaatacaagtgaaattaagtcggttattgttaggaag
tccacatttgctgaatttcctgaaatttttttaattcatttatcaagatcagtcttcaat
gggatgaactattcaaggaatccatgtcaagttgagtttgaagaagaaattttgttacca
agacaaatattgaaggaccaccaatgtgtagggtttgaaacggtcaaatataaacttaaa
tcaattgtaaagcacacaggctcacattatcaaggccactatcagtgttatagacacaaa
ccaacacttttattggagaaggtgacaggaaatatcatcaacggctctccaataataaca
cttaacactcttcaaagtactgtatcaacaaccagctgctctctggagaacgaagaacga
tttcaaaatttgaaggaagataagaagaaattgaaattactcaaaagtgtcaagatgaat
ccttactggtggatttcagattcatctgtaaaggaatgtaaggtctcaagggtgcttgat
gaaaagaaatatgtttacatgctttattatgaacgtatacattga

DBGET integrated database retrieval system