KEGG   Naumovozyma castellii: NCAS_0C03220Help
Entry
NCAS_0C03220      CDS       T02233                                 

Gene name
NCAS0C03220
Definition
(RefSeq) hypothetical protein
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00564  Glycerophospholipid metabolism
ncs01100  Metabolic pathways
Module
ncs_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCAS_0C03220 (NCAS0C03220)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCAS_0C03220 (NCAS0C03220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH
Motif
Other DBs
NCBI-GeneID: 11526511
NCBI-ProteinID: XP_003675677
UniProt: G0VCV1
Position
3:complement(633368..635044)
Genome map
AA seq 558 aa AA seqDB search
MQLNMPSRHSRSHSRSSSTSTRRPSLTRHRSSQRLVRTISIESFDSLSLEPTAASSEPPQ
TPPTFTSEESTEYIEVPFVKASLDPTLPQDYLKDDILNLIIQLQIPKWYHHRNSTTREQL
QLTKIKGAMTNAIFKIAYPGLPSLLLRIYGPNNDTIIDREYELQVLARLSVRHIGPSLFG
CFSNGRFEQFLENATTLNKDDIRDWKISQRIARRMKELHIGVPLLPQEKTHGPAAWQKIV
KWMDVLDKGDYAWIAQDKNIQDVLFCRDWSHFKKVVNTYQTWLSKQAGSSNLVFCHNDAQ
YGNLLFSAPLVRSQSTDTITDSSAPISTVSSTGSLFPVTSKIQIDAIIKPTRQEQSQDSK
LVVIDFEYSGANPAAYDLANHFSEWMYDYNGSEPHKASQDMWPTKEQILNFVYSYVSHLR
GGARDPIDEEVKMLYNSILQWRATAQLFWSIWAILQSGKLDDKSKQEQEVLFDGPNGEQY
IIKTDKEQDETGVDDVCDEEEEEDEEKKGGVDIDSFDYMAYCKDKITLFWGDLIKFDVVD
AADCYKPDSVRYLDTELI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgaacatgccttcaagacattccagatcgcactcccgatcatcaagcacaagt
accaggagaccctctctgacaagacataggtcatctcaacggttagttcgcacgataagt
atagaatccttcgattcactgtccctcgaacccactgctgcctcttcagaaccaccacaa
acacctccaacatttacatcggaagaatccacagaatacatagaggtacccttcgtgaag
gcaagcttggacccgactttaccgcaagactatctaaaggatgatatcctcaatctaata
atacagttacaaattcccaaatggtaccaccatagaaactccactacccgtgaacaactt
caattgaccaaaataaagggtgccatgacgaacgccatcttcaaaatcgcatacccaggc
ctcccctctcttctacttcgaatttacggacccaataacgacactattattgatagagag
tatgagttgcaagttttagcacgtctttccgtgcgtcatattgggccctctctgtttgga
tgcttctctaatggtagattcgagcaattcctcgagaacgcaaccacgttgaataaagac
gatataagggactggaagatatcacaacggatcgctagaagaatgaaggaactacacatt
ggggtacccttattaccacaggagaagacacatggacctgctgcatggcagaagattgtc
aaatggatggatgtgttagacaagggtgattacgcatggatcgcccaggacaagaacatt
caggatgtgttgttttgtagggactggtctcattttaagaaggtggtcaatacataccaa
acatggctctctaagcaagctggatcctccaatttggtattctgtcacaacgatgcacaa
tacggtaacttactattcagtgcgcctttggtccgatcacaatccacagatacaattacg
gattcctctgcacccatatcgacagtttcatcgacaggatcattgttcccagtcacatcc
aaaatccaaattgatgccatcatcaaacccacccgtcaagaacagagtcaggattccaag
ctcgtcgtcatagatttcgaatattccggcgccaacccagcagcatacgacttggctaac
catttcagtgaatggatgtacgattacaatggctctgaaccacataaggcatcgcaggac
atgtggcccacgaaggaacaaatcttaaatttcgtttattcatatgtgtcacatttgaga
ggtggtgccagggaccccatagatgaggaagtgaaaatgttatataattctatcttgcaa
tggagagctacagctcaattgttttggtctatttgggctatcttgcagagcgggaaattg
gatgacaagagcaagcaggagcaagaagtattgttcgatggacccaatggagaacagtac
attatcaagactgataaggagcaagatgagacaggtgtagacgatgtgtgcgacgaagaa
gaagaggaggacgaggagaagaagggaggtgtcgatatcgattcattcgattacatggct
tactgtaaggataaaatcactttgttttggggtgatctgatcaaatttgatgtggtggat
gccgctgactgttacaaacccgattcagtgagatatctggatactgaacttatataa

DBGET integrated database retrieval system