KEGG   Naumovozyma castellii: NCAS_0C03220Help
Entry
NCAS_0C03220      CDS       T02233                                 

Gene name
NCAS0C03220
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCAS_0C03220 (NCAS0C03220)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NCAS_0C03220 (NCAS0C03220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(633368..635044)
Genome map
AA seq 558 aa AA seqDB search
MQLNMPSRHSRSHSRSSSTSTRRPSLTRHRSSQRLVRTISIESFDSLSLEPTAASSEPPQ
TPPTFTSEESTEYIEVPFVKASLDPTLPQDYLKDDILNLIIQLQIPKWYHHRNSTTREQL
QLTKIKGAMTNAIFKIAYPGLPSLLLRIYGPNNDTIIDREYELQVLARLSVRHIGPSLFG
CFSNGRFEQFLENATTLNKDDIRDWKISQRIARRMKELHIGVPLLPQEKTHGPAAWQKIV
KWMDVLDKGDYAWIAQDKNIQDVLFCRDWSHFKKVVNTYQTWLSKQAGSSNLVFCHNDAQ
YGNLLFSAPLVRSQSTDTITDSSAPISTVSSTGSLFPVTSKIQIDAIIKPTRQEQSQDSK
LVVIDFEYSGANPAAYDLANHFSEWMYDYNGSEPHKASQDMWPTKEQILNFVYSYVSHLR
GGARDPIDEEVKMLYNSILQWRATAQLFWSIWAILQSGKLDDKSKQEQEVLFDGPNGEQY
IIKTDKEQDETGVDDVCDEEEEEDEEKKGGVDIDSFDYMAYCKDKITLFWGDLIKFDVVD
AADCYKPDSVRYLDTELI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgaacatgccttcaagacattccagatcgcactcccgatcatcaagcacaagt
accaggagaccctctctgacaagacataggtcatctcaacggttagttcgcacgataagt
atagaatccttcgattcactgtccctcgaacccactgctgcctcttcagaaccaccacaa
acacctccaacatttacatcggaagaatccacagaatacatagaggtacccttcgtgaag
gcaagcttggacccgactttaccgcaagactatctaaaggatgatatcctcaatctaata
atacagttacaaattcccaaatggtaccaccatagaaactccactacccgtgaacaactt
caattgaccaaaataaagggtgccatgacgaacgccatcttcaaaatcgcatacccaggc
ctcccctctcttctacttcgaatttacggacccaataacgacactattattgatagagag
tatgagttgcaagttttagcacgtctttccgtgcgtcatattgggccctctctgtttgga
tgcttctctaatggtagattcgagcaattcctcgagaacgcaaccacgttgaataaagac
gatataagggactggaagatatcacaacggatcgctagaagaatgaaggaactacacatt
ggggtacccttattaccacaggagaagacacatggacctgctgcatggcagaagattgtc
aaatggatggatgtgttagacaagggtgattacgcatggatcgcccaggacaagaacatt
caggatgtgttgttttgtagggactggtctcattttaagaaggtggtcaatacataccaa
acatggctctctaagcaagctggatcctccaatttggtattctgtcacaacgatgcacaa
tacggtaacttactattcagtgcgcctttggtccgatcacaatccacagatacaattacg
gattcctctgcacccatatcgacagtttcatcgacaggatcattgttcccagtcacatcc
aaaatccaaattgatgccatcatcaaacccacccgtcaagaacagagtcaggattccaag
ctcgtcgtcatagatttcgaatattccggcgccaacccagcagcatacgacttggctaac
catttcagtgaatggatgtacgattacaatggctctgaaccacataaggcatcgcaggac
atgtggcccacgaaggaacaaatcttaaatttcgtttattcatatgtgtcacatttgaga
ggtggtgccagggaccccatagatgaggaagtgaaaatgttatataattctatcttgcaa
tggagagctacagctcaattgttttggtctatttgggctatcttgcagagcgggaaattg
gatgacaagagcaagcaggagcaagaagtattgttcgatggacccaatggagaacagtac
attatcaagactgataaggagcaagatgagacaggtgtagacgatgtgtgcgacgaagaa
gaagaggaggacgaggagaagaagggaggtgtcgatatcgattcattcgattacatggct
tactgtaaggataaaatcactttgttttggggtgatctgatcaaatttgatgtggtggat
gccgctgactgttacaaacccgattcagtgagatatctggatactgaacttatataa

DBGET integrated database retrieval system