KEGG   Naumovozyma castellii: NCAS_0C03380Help
Entry
NCAS_0C03380      CDS       T02233                                 

Gene name
NCAS0C03380
Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ncs  Naumovozyma castellii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCAS_0C03380 (NCAS0C03380)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCAS_0C03380 (NCAS0C03380)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   NCAS_0C03380 (NCAS0C03380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(664012..665310)
Genome map
AA seq 432 aa AA seqDB search
MATHEEFIRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSVGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDV
INTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRVTAAEALAHP
YLAPYHDPTDEPVADCKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGGDGQIDTSATFD
DQVAAATAAAAQAQAHAQAQAQAQAKNGSTSQNGDSNNNTNNNNNSGNGTENNDAISRFA
DQAVHYANEFQQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctactcacgaggaattcataagaactcaaatattcggaacagtgttcgagataaca
aacagatacaccgatttaaatcctgtcggtatgggggccttcgggttggtttgttccgct
actgacacattaacaagtcaaccagtcgccatcaaaaaaattatgaaaccattctccacc
gctgtcttagcaaagagaacttatagagaattaaaacttttgaaacatctaagacatgaa
aatttaatctgtttgcaagatatcttcttgtcccccttggaagatatttatttcgtgacg
gaattacaaggtactgatttacacagattgttacaaacaaggcctctggaaaagcaattc
gttcaatacttcctttatcaaatcctaagaggtttgaaatatgttcattccgtaggtgtc
atacatagagatttaaaaccaagcaatatcctgattaatgaaaattgtgatttgaaaatt
tgtgattttggtcttgcaagaattcaagatcctcaaatgacaggttatgtttccacacgt
tattacagagctccggaaattatgttgacttggcaaaaatatgacgtggaagttgatata
tggtccgctggttgtatattcgctgaaatgatagaggggaaacctttattcccaggaaag
gatcacgttcatcaattttctatcattaccgatttgttaggttcaccaccagaagatgtc
attaatacaatttgttcagaaaatactttgaaattcgtcacttcattacctcatagagat
ccaatcccattctcggaaagatttaaaacggtggaacctgatgctgtggatttattgggt
aagatgcttgtctttgatccaaagaaaagagttaccgcagcagaagcattggcccatcca
tatttggctccatatcatgatccaacagatgaacccgtcgctgattgtaaatttgactgg
catttcaatgatgctgacctaccagtggatacatggagagtaatgatgtattcggaaatc
ttagatttccataagattggtggcggagatggtcaaattgatacttctgccacatttgat
gatcaagttgctgccgccactgctgctgctgctcaggcacaggcccatgcacaagctcag
gctcaagcacaagccaagaatggttccacctcacaaaatggcgatagcaataataacacc
aacaataataataacagtggcaatggcactgaaaataatgatgcaatttcaagattcgct
gatcaagcagttcattatgccaatgagtttcaacaataa

DBGET integrated database retrieval system