KEGG   Naumovozyma castellii: NCAS_0C03520Help
Entry
NCAS_0C03520      CDS       T02233                                 

Gene name
NCAS0C03520
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ncs  Naumovozyma castellii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCAS_0C03520 (NCAS0C03520)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NCAS_0C03520 (NCAS0C03520)
Transfer RNA biogenesis [BR:ncs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NCAS_0C03520 (NCAS0C03520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(702297..703382)
Genome map
AA seq 361 aa AA seqDB search
MVFEKELLLATQAVRKASLLTKRIQSEVIAHRDSTTITKTDNSPVTIGDYAAQTIIINAI
KANFPDDKIVGEESAEGLEDGFVSEILKEIEINDTVFQGEYSNDDDVGFKFVDKSFPLKS
IEDVKQIINFGDYEGGRQGRFWCLDPIDGTKGFLRGEQFAVCLALIVDGVVQVGCIGCPN
LTLSDYTDSVKDIPGHESFGYIFRAVRGSGAFYSTASIAKEWTQIHVRDIKNTNEMITLE
GVEKGHSSHDEQSQIKEQLGVTKSLHLDSQVKYCILALGLADLYLRLPIKMSYEEKIWDH
GAGNVIVHEAGGFHTDSMKDVPLDFGCGRTLKTKGVIASSGPKELHDLIVATSKKVISQR
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtattcgaaaaggaattgttgctagccactcaagcagtccgtaaagcgtctcttctc
accaagaggattcaatctgaagtgatcgcacacagggattccaccaccattacaaagact
gataattcacccgtgaccatcggtgattatgctgcacaaacaatcatcatcaatgctatc
aaggctaacttcccagatgacaaaattgtcggtgaggaatctgccgaaggtttggaggat
gggtttgtctctgaaatcctaaaggagattgaaattaatgataccgttttccaaggggaa
tactcgaacgatgatgatgttggattcaagtttgtggataaaagtttcccattgaagtct
attgaagatgttaaacaaattattaatttcggggattacgaaggaggtagacaagggaga
ttttggtgtttggatccaattgatggtaccaaggggttcttgagaggagaacaattcgct
gtctgtttagcattaattgtggatggtgttgtccaagttgggtgcattggctgtcctaat
ttaaccctaagtgattatactgactctgtgaaggatattccaggccatgaatcatttggt
tacatcttccgtgctgtaagaggctcaggtgccttctattccactgcatcaattgctaaa
gaatggactcagatccacgtaagagacataaagaacactaatgagatgatcactttggaa
ggtgtggaaaagggtcattcctctcacgacgaacaatcccaaattaaggaacaactgggt
gtaacaaagtcattacatttagactcgcaggtgaaatactgtattctagcgcttggatta
gcagatctttacttgcgtttacctattaagatgtcttacgaggaaaagatttgggatcat
ggggccggaaatgttatcgtccatgaagctggagggttccacactgattctatgaaagat
gttccattggattttggttgtgggagaaccttaaagactaaaggtgtgattgcttccagt
ggtcctaaggaattacacgatttgattgtggctacatccaagaaagtcatttcccaaaga
aagtag

DBGET integrated database retrieval system