KEGG   Naumovozyma castellii: NCAS_0C04420Help
Entry
NCAS_0C04420      CDS       T02233                                 

Gene name
NCAS0C04420
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ncs  Naumovozyma castellii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCAS_0C04420 (NCAS0C04420)
Translation factors [BR:ncs03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NCAS_0C04420 (NCAS0C04420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(905034..905669)
Genome map
AA seq 211 aa AA seqDB search
MSVEEVSQKLEAVSVSNDDTPKTVLTDSNNFEVKHPLNSKWTLWYTKPAVDKSESWSDLL
RPVTTFETVEEFWAIVQNIPEPHELPLKSDYHVFRGDIRPEWEDEANAKGGKWSFQLRGK
GSDIDELWLRTLLAVIGETIDEEDSQINGVVLSIRKGGNKFALWTRSEDEQALRNIGAKF
KQVLKLTEDGHLEFFPHSSANERHAQPTIVL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgaagaagtcagtcaaaaattagaagctgtttctgtcagtaatgatgacact
ccaaagaccgtcttaactgacagtaataattttgaagttaaacaccctttgaactctaag
tggactttgtggtacaccaagcctgcggtagataagtcagaatcctggtccgatttattg
agaccagttactacttttgaaactgtcgaagaattctgggctattgtacaaaatattcca
gaacctcatgaactaccactaaaatccgattatcatgttttccgtggtgacattagacct
gaatgggaagatgaagctaatgccaagggtggtaagtggtcctttcaattaagaggtaaa
ggtagtgatattgatgaattgtggctaagaactttactagccgtcatcggtgaaactatc
gatgaagaagactcccaaattaacggtgttgtgttaagtattagaaagggtggtaacaaa
tttgcattatggaccaggtccgaagatgaacaagctttgcgtaacatcggtgctaagttc
aagcaagttttgaagttgactgaagatggacatttagaatttttccctcattcttctgct
aatgaaagacatgcccaaccaaccattgttttataa

DBGET integrated database retrieval system