KEGG   Naumovozyma castellii: NCAS_0C04500Help
Entry
NCAS_0C04500      CDS       T02233                                 

Gene name
NCAS0C04500
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ncs  Naumovozyma castellii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:ncs03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ncs03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ncs03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ncs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(922697..922703,922781..923613)
Genome map
AA seq 279 aa AA seqDB search
MATYQPYTEFSSVTGGGFDNSDRPNSGDADGAVNRTNTLHPVTIKQILESTQEIQDGPFV
SHNQELHHVCFVGVVRNITDHTSNIYLTIEDGTGQIEVRKWSDDATDMAAGNNEEDKQGS
SQAAQQYQMGTYVKIFGALKEFGGKKNIQYAVIKNVESFNEVLAHHLEVIKWHAIANGKI
PNPSTGSGEPLQQGAMGGNQSGQSLFVTENESNHSISDRILEFCKKQCEGKDANAFAVPI
PLIAQSLNIDENTARNCCTTLTEQGFIYPTFDDNNFFAL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttatcaaccttacacagagttctcttcagttacaggaggtggttttgataac
tcagatagacctaattcaggtgatgcagatggagcagttaacagaacgaacactcttcat
ccagtgaccattaagcaaattttagaatccacccaagaaattcaagatggtcccttcgtc
tctcacaatcaagaacttcatcatgtttgtttcgttggtgttgtaaggaatattacagat
catacatctaatatatatcttacaatcgaagatggtacgggccaaattgaagtgagaaaa
tggagtgacgatgctactgacatggctgcaggaaataatgaagaagataagcaaggtagt
tctcaagcagcacaacagtatcaaatgggtacctatgttaagatatttggtgctctaaaa
gaatttggtgggaagaaaaatattcaatatgctgtcatcaagaatgtggaaagcttcaat
gaagtgctggctcaccatttagaagttataaaatggcatgctattgccaatggcaagatt
ccaaatccgtcaaccggttccggagaacctttacagcaaggagcaatgggtggaaatcaa
agtgggcaatcattatttgtcactgagaatgaatcaaaccattctatatctgatagaatt
ttagaattttgtaagaagcaatgtgagggtaaagacgccaatgcatttgcagttccaatt
cctcttattgcacaatcgttgaatatagatgagaataccgcaagaaattgttgtacaacg
ctaactgaacaaggttttatatacccaacctttgatgataataatttctttgcgttataa

DBGET integrated database retrieval system