KEGG   Naumovozyma castellii: NCAS_0C04500Help
Entry
NCAS_0C04500      CDS       T02233                                 

Gene name
NCAS0C04500
Definition
(RefSeq) hypothetical protein
  KO
K10739  
replication factor A2
Organism
ncs  Naumovozyma castellii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCAS_0C04500 (NCAS0C04500)
   03420 Nucleotide excision repair
    NCAS_0C04500 (NCAS0C04500)
   03430 Mismatch repair
    NCAS_0C04500 (NCAS0C04500)
   03440 Homologous recombination
    NCAS_0C04500 (NCAS0C04500)
DNA replication proteins [BR:ncs03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    NCAS_0C04500 (NCAS0C04500)
DNA repair and recombination proteins [BR:ncs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     NCAS_0C04500 (NCAS0C04500)
   MMR (mismatch exicision repair)
     NCAS_0C04500 (NCAS0C04500)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     NCAS_0C04500 (NCAS0C04500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(922697..922703,922781..923613)
Genome map
AA seq 279 aa AA seqDB search
MATYQPYTEFSSVTGGGFDNSDRPNSGDADGAVNRTNTLHPVTIKQILESTQEIQDGPFV
SHNQELHHVCFVGVVRNITDHTSNIYLTIEDGTGQIEVRKWSDDATDMAAGNNEEDKQGS
SQAAQQYQMGTYVKIFGALKEFGGKKNIQYAVIKNVESFNEVLAHHLEVIKWHAIANGKI
PNPSTGSGEPLQQGAMGGNQSGQSLFVTENESNHSISDRILEFCKKQCEGKDANAFAVPI
PLIAQSLNIDENTARNCCTTLTEQGFIYPTFDDNNFFAL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttatcaaccttacacagagttctcttcagttacaggaggtggttttgataac
tcagatagacctaattcaggtgatgcagatggagcagttaacagaacgaacactcttcat
ccagtgaccattaagcaaattttagaatccacccaagaaattcaagatggtcccttcgtc
tctcacaatcaagaacttcatcatgtttgtttcgttggtgttgtaaggaatattacagat
catacatctaatatatatcttacaatcgaagatggtacgggccaaattgaagtgagaaaa
tggagtgacgatgctactgacatggctgcaggaaataatgaagaagataagcaaggtagt
tctcaagcagcacaacagtatcaaatgggtacctatgttaagatatttggtgctctaaaa
gaatttggtgggaagaaaaatattcaatatgctgtcatcaagaatgtggaaagcttcaat
gaagtgctggctcaccatttagaagttataaaatggcatgctattgccaatggcaagatt
ccaaatccgtcaaccggttccggagaacctttacagcaaggagcaatgggtggaaatcaa
agtgggcaatcattatttgtcactgagaatgaatcaaaccattctatatctgatagaatt
ttagaattttgtaagaagcaatgtgagggtaaagacgccaatgcatttgcagttccaatt
cctcttattgcacaatcgttgaatatagatgagaataccgcaagaaattgttgtacaacg
ctaactgaacaaggttttatatacccaacctttgatgataataatttctttgcgttataa

DBGET integrated database retrieval system