KEGG   Naumovozyma castellii: NCAS_0C05520Help
Entry
NCAS_0C05520      CDS       T02233                                 

Gene name
NCAS0C05520
Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ncs  Naumovozyma castellii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCAS_0C05520 (NCAS0C05520)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCAS_0C05520 (NCAS0C05520)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCAS_0C05520 (NCAS0C05520)
Enzymes [BR:ncs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCAS_0C05520 (NCAS0C05520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1119552..1121675
Genome map
AA seq 707 aa AA seqDB search
MTEQLRETFAQAKRENRRALVTFMTAGYPTVDETIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNTVALENGVSLEQTLDLVKQARDQGVTVPIILMGYYNPILNYGEEKLIRDAA
EAGANGFIIVDLPPEEAIKVRGFVAEVGLSLIPLVAPSTTDDRLELLSHIADSFVYVVSR
MGTTGAQTSVASNLDQLVARVRKHTKEIPIAVGFGVSTREHFQAVGSLADGVVIGSKIVT
LCKEAPKGKCYDTSKNYVEEILAGVKHKLLTKDEYFELKESSIASGKNHKKEVNEFDEKH
KHPIRFGEFGGQYVPEALHACLSELEKGFEEAIADPTFWEEFRSLYSYIGRPSSLHRAER
LTEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKTNIIAETGAGQHGVATATAC
AKFGLKCTVYMGAEDVRRQALNVFRMRILGAEVVSVTNGTQTLRDATSEAFRSWVTNLKN
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFAAMNDGKLPNAIVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGIDTAYHSATLTVGRPGVFHGVKTYVLQDEDGQVHDTHSVSA
GLDYPGVGPELAFWKSTGRAQFVAATDAQALEGSKLLSQLEGIIPALESSHAVYGAVQLA
KAMKPEEHLIINISGRGDKDVQSVAEVLPKLGPQIGWDLRFEADPSA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaattaagagaaacatttgcccaggctaagagagaaaatcgtcgtgcttta
gtcacgtttatgaccgcaggttatccaactgttgacgaaactattccaatcttaaaaggt
ttccaagatggtggtgtagatgtcatcgaattaggtatgccattctcagaccctattgct
gatggtcctaccattcaagtttccaatactgttgccctagaaaatggtgttagcttagaa
caaactttagatttagtgaaacaagcaagagatcaaggtgtgacagttcctattatccta
atggggtactacaaccctatcttaaactacggtgaagaaaaattgattagagatgccgct
gaggcaggtgccaatgggttcatcatcgttgatttaccaccagaagaagccattaaagta
agaggatttgtcgccgaagtgggattaagtttgatcccattagtcgcaccttctaccact
gatgacagattagaattattgtctcatatcgccgactcatttgtttatgtcgtttcaaga
atgggtactaccggtgctcaaacatcagtagcttctaatttagatcaattagtcgcaaga
gtaagaaaacatactaaggaaatcccaattgccgtcggttttggtgtctccacaagagaa
catttccaagctgtgggttctttagctgatggtgttgtcattggttctaagatcgttact
ctttgtaaagaagctcctaagggtaaatgttatgatacttccaagaattacgtggaagaa
attcttgctggtgttaagcataaattactaactaaggatgaatacttcgaactaaaggaa
tcatcaattgctagtggtaagaatcataagaaggaagtaaacgaatttgatgaaaagcat
aaacatccaatcagatttggtgaatttggtggtcaatatgttccagaagctctccatgca
tgtctaagtgaattagaaaagggtttcgaagaagccattgccgacccaactttctgggaa
gaattcagatcattatactcttacattggtcgtccatcttctcttcatagagctgaaaga
ttgactgaatattgtggtggtgctcaaatctggttgaagagagaagacttaaaccacacc
ggttctcataagattaataacgctctagcacaagttcttattgccaaaaggttaggtaag
accaatatcattgcagaaactggtgcaggacaacatggtgtcgcaacagctactgcatgt
gccaaattcggtttgaaatgtactgtctacatgggtgctgaagatgtccgtcgtcaagcc
ttaaacgttttcagaatgagaattctaggtgccgaagttgtttcagtgacaaatggtact
caaacgttaagagatgccacatccgaagccttccgttcttgggtgacaaacttaaagaat
acttactatgtggtgggttctgctattggtccacatccatacccaactttggtgcgtact
ttccaaagtgtcattggtaaggaaaccaaggagcaatttgctgctatgaatgatggaaaa
ctaccaaatgctattgttgcctgtgtcggtggtggttctaactctactggtatgttctct
ccattcgaacatgacacttccgtgaaactattgggtgtcgaagcaggtggtgacggtatt
gacactgcataccattctgccactctaacagtgggtagaccaggtgttttccacggtgtg
aaaacttacgtgcttcaagatgaagacggtcaagttcacgatacccattctgtctcagct
ggtttagattacccaggtgtcggtccagaactagcgttctggaaatctaccggtcgtgcc
caattcgtggctgccactgatgctcaagcactagagggttccaaactcttatcacaattg
gaaggtattattccagctttagaatcatctcatgctgtttacggtgctgttcaactggct
aaggcaatgaaaccagaagaacatttgattattaacatttctggtagaggtgacaaggat
gtacaaagtgtcgctgaagttttaccaaaattgggaccacaaattggttgggatttaaga
tttgaagctgacccatctgcttaa

DBGET integrated database retrieval system