KEGG   Naumovozyma castellii: NCAS_0C05520Help
Entry
NCAS_0C05520      CDS       T02233                                 

Gene name
NCAS0C05520
Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ncs  Naumovozyma castellii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCAS_0C05520 (NCAS0C05520)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCAS_0C05520 (NCAS0C05520)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCAS_0C05520 (NCAS0C05520)
Enzymes [BR:ncs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCAS_0C05520 (NCAS0C05520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3:1119552..1121675
Genome map
AA seq 707 aa AA seqDB search
MTEQLRETFAQAKRENRRALVTFMTAGYPTVDETIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNTVALENGVSLEQTLDLVKQARDQGVTVPIILMGYYNPILNYGEEKLIRDAA
EAGANGFIIVDLPPEEAIKVRGFVAEVGLSLIPLVAPSTTDDRLELLSHIADSFVYVVSR
MGTTGAQTSVASNLDQLVARVRKHTKEIPIAVGFGVSTREHFQAVGSLADGVVIGSKIVT
LCKEAPKGKCYDTSKNYVEEILAGVKHKLLTKDEYFELKESSIASGKNHKKEVNEFDEKH
KHPIRFGEFGGQYVPEALHACLSELEKGFEEAIADPTFWEEFRSLYSYIGRPSSLHRAER
LTEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKTNIIAETGAGQHGVATATAC
AKFGLKCTVYMGAEDVRRQALNVFRMRILGAEVVSVTNGTQTLRDATSEAFRSWVTNLKN
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFAAMNDGKLPNAIVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGIDTAYHSATLTVGRPGVFHGVKTYVLQDEDGQVHDTHSVSA
GLDYPGVGPELAFWKSTGRAQFVAATDAQALEGSKLLSQLEGIIPALESSHAVYGAVQLA
KAMKPEEHLIINISGRGDKDVQSVAEVLPKLGPQIGWDLRFEADPSA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaattaagagaaacatttgcccaggctaagagagaaaatcgtcgtgcttta
gtcacgtttatgaccgcaggttatccaactgttgacgaaactattccaatcttaaaaggt
ttccaagatggtggtgtagatgtcatcgaattaggtatgccattctcagaccctattgct
gatggtcctaccattcaagtttccaatactgttgccctagaaaatggtgttagcttagaa
caaactttagatttagtgaaacaagcaagagatcaaggtgtgacagttcctattatccta
atggggtactacaaccctatcttaaactacggtgaagaaaaattgattagagatgccgct
gaggcaggtgccaatgggttcatcatcgttgatttaccaccagaagaagccattaaagta
agaggatttgtcgccgaagtgggattaagtttgatcccattagtcgcaccttctaccact
gatgacagattagaattattgtctcatatcgccgactcatttgtttatgtcgtttcaaga
atgggtactaccggtgctcaaacatcagtagcttctaatttagatcaattagtcgcaaga
gtaagaaaacatactaaggaaatcccaattgccgtcggttttggtgtctccacaagagaa
catttccaagctgtgggttctttagctgatggtgttgtcattggttctaagatcgttact
ctttgtaaagaagctcctaagggtaaatgttatgatacttccaagaattacgtggaagaa
attcttgctggtgttaagcataaattactaactaaggatgaatacttcgaactaaaggaa
tcatcaattgctagtggtaagaatcataagaaggaagtaaacgaatttgatgaaaagcat
aaacatccaatcagatttggtgaatttggtggtcaatatgttccagaagctctccatgca
tgtctaagtgaattagaaaagggtttcgaagaagccattgccgacccaactttctgggaa
gaattcagatcattatactcttacattggtcgtccatcttctcttcatagagctgaaaga
ttgactgaatattgtggtggtgctcaaatctggttgaagagagaagacttaaaccacacc
ggttctcataagattaataacgctctagcacaagttcttattgccaaaaggttaggtaag
accaatatcattgcagaaactggtgcaggacaacatggtgtcgcaacagctactgcatgt
gccaaattcggtttgaaatgtactgtctacatgggtgctgaagatgtccgtcgtcaagcc
ttaaacgttttcagaatgagaattctaggtgccgaagttgtttcagtgacaaatggtact
caaacgttaagagatgccacatccgaagccttccgttcttgggtgacaaacttaaagaat
acttactatgtggtgggttctgctattggtccacatccatacccaactttggtgcgtact
ttccaaagtgtcattggtaaggaaaccaaggagcaatttgctgctatgaatgatggaaaa
ctaccaaatgctattgttgcctgtgtcggtggtggttctaactctactggtatgttctct
ccattcgaacatgacacttccgtgaaactattgggtgtcgaagcaggtggtgacggtatt
gacactgcataccattctgccactctaacagtgggtagaccaggtgttttccacggtgtg
aaaacttacgtgcttcaagatgaagacggtcaagttcacgatacccattctgtctcagct
ggtttagattacccaggtgtcggtccagaactagcgttctggaaatctaccggtcgtgcc
caattcgtggctgccactgatgctcaagcactagagggttccaaactcttatcacaattg
gaaggtattattccagctttagaatcatctcatgctgtttacggtgctgttcaactggct
aaggcaatgaaaccagaagaacatttgattattaacatttctggtagaggtgacaaggat
gtacaaagtgtcgctgaagttttaccaaaattgggaccacaaattggttgggatttaaga
tttgaagctgacccatctgcttaa

DBGET integrated database retrieval system