KEGG   Naumovozyma castellii: NCAS_0C05900Help
Entry
NCAS_0C05900      CDS       T02233                                 

Gene name
NCAS0C05900
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NCAS_0C05900 (NCAS0C05900)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NCAS_0C05900 (NCAS0C05900)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCAS_0C05900 (NCAS0C05900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1214812..1216923
Genome map
AA seq 703 aa AA seqDB search
MSHWLSFARTTSLLFRSKPIRINFTKSKNNRLLMTLSKGTQEKIRTASNDGDYIPLIASI
DVGTTSSRAILFNKMGQEIEKHQIEYSTSASKGKYSVLGKRRFSDESNETTEVPSNKPST
IFSAEGVTIRQTPNLEIEDLLLNQSASTTAAHLSMSGPTLEFPKPGWIQCNPMALLANVV
QCLGSTLVSLSDLNKDRIKKSFPPYKIGCIGITNMRETTLVWSKSTGLPIINYGIVWNDT
RNLPLIRTLQETVSNETAKKITKKTGLPLFSTYFSCSKLKWLLENEPLVQKAYQEKDLMF
GTVDTWLLYNLTVEKAFVSDITNASRTGFMDLNSLDYDDELLSFWRIDPKLVHLPKIVSC
SEYYGQLTIPEFTKNLLSTEIWEELNRFKNSRVPIQGCIGDQSASLVGQLAFKTGSAKCT
YGTGCFLLYNTGTEKMISEHGALTTPAYWFPNSTEQPEPHFALEGSIAVGGSVVQWLRDN
LRLIPKSEHIGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIARA
AIEGVCFQVRAILKAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIK
LRRSPIVECTALGAAIAANMAYKKEAERILWKDLNDVKKWIMYNGYDKDEGMPTIMHDNL
AVFKSSIDDAERRKHWKLWQVAVKRSRGWLTDVDGEHEDVLEP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattggctttcttttgctagaacaacctccctactatttcgatcaaagccaata
agaataaactttaccaaatctaaaaacaatcgtctattaatgactctatccaaaggaact
caagaaaaaattcgcaccgcctccaatgatggggactatattccgttaattgcctctatt
gatgtggggactacctcgtcgagagccattcttttcaacaagatgggccaagagattgaa
aagcatcagatagaatattcaacttcggcatcgaagggtaagtattcagtgctaggtaag
agaagattttcagatgaaagtaatgaaacaacggaagtaccatcaaataaaccttccacc
atcttttctgctgaaggtgttaccattagacaaactccaaatctggaaattgaagactta
ttactcaatcaatcagcgtccaccactgccgctcacctctcgatgtctggccctactttg
gaatttcccaagccgggttggattcagtgtaatcctatggcattattggctaacgtagtt
cagtgtctaggttccactttagtatcactatctgacttgaataaggatcgtatcaagaaa
tcattccctccttacaaaataggttgcatcggaattaccaacatgagagaaacaacctta
gtctggtcaaaatctaccgggctaccaattattaattatggtattgtatggaatgatact
agaaatttacctttaataagaacactacaggaaactgtttccaatgaaactgcaaagaag
ataactaaaaagactggtcttccattattttccacttatttttcctgctcaaaactgaag
tggctattggaaaacgaaccacttgtacaaaaggcttatcaagagaaagacttgatgttt
ggtactgttgatacatggttactctataacctgacagttgaaaaggcctttgtttccgat
attacaaatgcatcaagaactgggtttatggatttgaattccttggactacgatgatgaa
ctattatccttttggaggattgatccaaaacttgttcatttacccaaaattgtttcatgt
tccgaatattatggacaattaactatcccagaatttaccaaaaatttgttgtcaactgag
atttgggaagaattgaatagatttaagaattccagggttccaatccaaggctgcatcggt
gatcaaagcgcatcattagtgggacagttggcatttaagacaggctctgccaaatgtaca
tatggtactggctgtttcctattatataatactggtaccgaaaaaatgatctctgaacat
ggggctctaacaacaccagcatattggttcccaaattccacggaacaacctgaacctcat
tttgcattagagggttccattgcagttggtgggtctgtagttcagtggttacgtgataat
ttaagattaattcctaaatcggaacatattggtcccttagcatccagagttcgtgattca
ggcggtgttgtatttgtccctgcatttaatggattatttgctccatattgggatcctgat
acaagggctacaatcatgggtatctctcaatctaccactgcatcccatattgctagagct
gccattgaaggtgtttgtttccaagttcgagccatattgaaggccatggggtctgatgaa
gtatatggggattcagcctacgagaagaagaacttggcaactttggcagttgatggagga
atgtccaaatcaaatgaagtgatgcaaattcaggctgatattttaggtccttgcattaaa
ctaagaaggtcacccattgttgaatgtactgcactaggtgctgctattgctgcaaatatg
gcatataagaaggaagccgaaagaatcctatggaaagatttgaatgacgttaagaaatgg
attatgtataatggatacgacaaagatgaaggtatgcctacaataatgcatgacaattta
gcagtctttaaaagcagtattgatgatgcggaaagaaggaagcattggaaattatggcaa
gtcgctgtaaagagatccagaggatggttaacagacgttgatggggaacacgaggacgtc
ctagaaccataa

DBGET integrated database retrieval system