KEGG   Naumovozyma castellii: NCAS_0C05900Help
Entry
NCAS_0C05900      CDS       T02233                                 

Gene name
NCAS0C05900
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ncs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1214812..1216923
Genome map
AA seq 703 aa AA seqDB search
MSHWLSFARTTSLLFRSKPIRINFTKSKNNRLLMTLSKGTQEKIRTASNDGDYIPLIASI
DVGTTSSRAILFNKMGQEIEKHQIEYSTSASKGKYSVLGKRRFSDESNETTEVPSNKPST
IFSAEGVTIRQTPNLEIEDLLLNQSASTTAAHLSMSGPTLEFPKPGWIQCNPMALLANVV
QCLGSTLVSLSDLNKDRIKKSFPPYKIGCIGITNMRETTLVWSKSTGLPIINYGIVWNDT
RNLPLIRTLQETVSNETAKKITKKTGLPLFSTYFSCSKLKWLLENEPLVQKAYQEKDLMF
GTVDTWLLYNLTVEKAFVSDITNASRTGFMDLNSLDYDDELLSFWRIDPKLVHLPKIVSC
SEYYGQLTIPEFTKNLLSTEIWEELNRFKNSRVPIQGCIGDQSASLVGQLAFKTGSAKCT
YGTGCFLLYNTGTEKMISEHGALTTPAYWFPNSTEQPEPHFALEGSIAVGGSVVQWLRDN
LRLIPKSEHIGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIARA
AIEGVCFQVRAILKAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIK
LRRSPIVECTALGAAIAANMAYKKEAERILWKDLNDVKKWIMYNGYDKDEGMPTIMHDNL
AVFKSSIDDAERRKHWKLWQVAVKRSRGWLTDVDGEHEDVLEP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattggctttcttttgctagaacaacctccctactatttcgatcaaagccaata
agaataaactttaccaaatctaaaaacaatcgtctattaatgactctatccaaaggaact
caagaaaaaattcgcaccgcctccaatgatggggactatattccgttaattgcctctatt
gatgtggggactacctcgtcgagagccattcttttcaacaagatgggccaagagattgaa
aagcatcagatagaatattcaacttcggcatcgaagggtaagtattcagtgctaggtaag
agaagattttcagatgaaagtaatgaaacaacggaagtaccatcaaataaaccttccacc
atcttttctgctgaaggtgttaccattagacaaactccaaatctggaaattgaagactta
ttactcaatcaatcagcgtccaccactgccgctcacctctcgatgtctggccctactttg
gaatttcccaagccgggttggattcagtgtaatcctatggcattattggctaacgtagtt
cagtgtctaggttccactttagtatcactatctgacttgaataaggatcgtatcaagaaa
tcattccctccttacaaaataggttgcatcggaattaccaacatgagagaaacaacctta
gtctggtcaaaatctaccgggctaccaattattaattatggtattgtatggaatgatact
agaaatttacctttaataagaacactacaggaaactgtttccaatgaaactgcaaagaag
ataactaaaaagactggtcttccattattttccacttatttttcctgctcaaaactgaag
tggctattggaaaacgaaccacttgtacaaaaggcttatcaagagaaagacttgatgttt
ggtactgttgatacatggttactctataacctgacagttgaaaaggcctttgtttccgat
attacaaatgcatcaagaactgggtttatggatttgaattccttggactacgatgatgaa
ctattatccttttggaggattgatccaaaacttgttcatttacccaaaattgtttcatgt
tccgaatattatggacaattaactatcccagaatttaccaaaaatttgttgtcaactgag
atttgggaagaattgaatagatttaagaattccagggttccaatccaaggctgcatcggt
gatcaaagcgcatcattagtgggacagttggcatttaagacaggctctgccaaatgtaca
tatggtactggctgtttcctattatataatactggtaccgaaaaaatgatctctgaacat
ggggctctaacaacaccagcatattggttcccaaattccacggaacaacctgaacctcat
tttgcattagagggttccattgcagttggtgggtctgtagttcagtggttacgtgataat
ttaagattaattcctaaatcggaacatattggtcccttagcatccagagttcgtgattca
ggcggtgttgtatttgtccctgcatttaatggattatttgctccatattgggatcctgat
acaagggctacaatcatgggtatctctcaatctaccactgcatcccatattgctagagct
gccattgaaggtgtttgtttccaagttcgagccatattgaaggccatggggtctgatgaa
gtatatggggattcagcctacgagaagaagaacttggcaactttggcagttgatggagga
atgtccaaatcaaatgaagtgatgcaaattcaggctgatattttaggtccttgcattaaa
ctaagaaggtcacccattgttgaatgtactgcactaggtgctgctattgctgcaaatatg
gcatataagaaggaagccgaaagaatcctatggaaagatttgaatgacgttaagaaatgg
attatgtataatggatacgacaaagatgaaggtatgcctacaataatgcatgacaattta
gcagtctttaaaagcagtattgatgatgcggaaagaaggaagcattggaaattatggcaa
gtcgctgtaaagagatccagaggatggttaacagacgttgatggggaacacgaggacgtc
ctagaaccataa

DBGET integrated database retrieval system