KEGG   Naumovozyma castellii: NCAS_0D00600Help
Entry
NCAS_0D00600      CDS       T02233                                 

Gene name
NCAS0D00600
Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:102081..103562
Genome map
AA seq 493 aa AA seqDB search
MPNLEFNIKHMGKIYPISLAETATAGHLKQEVEGLTKVPVARQKYMVKGGLSDDSVSNLS
SVIKAGSNVMLLGTPDADLISKPKGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNA
TLQALFRVDSIRDLILNYDPAKASPQDEMHHKIVLEMKRCFENLENKSYKSVMPLMLLNV
LRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFDIVFGDKFSDDFTVQFRTTIKDTNNE
EDVTIKENENDLKLQCHISSSTNFMKNGLIESLHEKIEKRSDITGVNSIYSVDKQITKLP
KYLTVQYVRFFWKRSTNKKSKILRKVVFPFQLDVSDMLTPEYQQEKIKVRDEFRKVEKAK
LESERETKKRKLQDTTDVDEVMTPREEFETEKALEQSEKEHWLSEFKKHFPPDLQPGENP
SSVYNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGES
DSALILMYKGFGL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctcgaatttaatatcaagcatatgggtaaaatttacccaatctccctggca
gaaaccgcaactgcaggacatttgaaacaggaagtggaaggattaactaaagtgcccgtg
gcccgccaaaaatatatggttaagggtggtctttctgatgattctgtgagtaacttatct
tcggtaattaaggcgggatctaatgtgatgttattggggaccccagacgcggatttaatt
tctaagcctaaggggacaaaccatttcattgaagatttgactcctgaccaacaaatgcaa
aagttcgattccaacccaattgggctacaaaatatggggaatacttgttatatgaatgca
actttacaagccctgtttagagtggatagtatcagagatttgatactgaattatgaccct
gctaaggctagtccacaagatgaaatgcaccataagattgtcttggaaatgaaacgatgt
tttgaaaatttggagaataagagttataaatctgtcatgcccttgatgcttctaaacgtg
ttaagaaaatgttatccacaatttgccgagcgtgacgcccaaggtggattttataaacaa
caagatgctgaagaattatttacacaattgtttcatacttttgatattgtcttcggtgat
aaattctctgatgacttcacagttcaatttagaactacgattaaggatactaataatgaa
gaagatgtcaccataaaggaaaatgaaaatgatttgaaactacagtgtcatatttctagt
tcaactaatttcatgaagaatgggttaatagaatctttgcatgaaaagattgaaaaaaga
tccgatatcactggtgtcaattccatatattctgtggataaacagattactaagttacct
aaatatttgacagtgcaatatgttaggtttttttggaagagatccaccaacaagaaatca
aagattttacgtaaagtggttttcccattccaattggacgtttcagatatgttaactcct
gagtatcaacaagagaagattaaagttagagatgaattcagaaaagttgaaaaggctaaa
ttagaaagtgaacgtgaaacaaagaagcgtaaattacaagatacgactgatgttgatgaa
gtcatgactccaagagaagagtttgaaacggaaaaagcattggaacagagtgaaaaagaa
cattggttgagcgaatttaaaaaacattttcctccagatttacaaccaggtgaaaaccct
tcatctgtatacaatttagtgggaatcattactcatcaaggtgccaattctgaatcaggt
cattatcaagcgtttattcgtgatgaaacagacgaaaataaatggtataaatttaatgat
gataaagtcagtgttgtcgaaaaggagaaaattgaagcattagcaggaggtggtgaaagt
gatagtgcattgatccttatgtataaaggattcggattatga

DBGET integrated database retrieval system