KEGG   Naumovozyma castellii: NCAS_0D02030Help
Entry
NCAS_0D02030      CDS       T02233                                 

Gene name
NCAS0D02030
Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCAS_0D02030 (NCAS0D02030)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCAS_0D02030 (NCAS0D02030)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:373910..376024
Genome map
AA seq 704 aa AA seqDB search
MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN
ESLWLQKRMQNTREPLLQFLNRSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGG
GYRSMLTGAGILAAMDNRTRGAQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQS
IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL
SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF
EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS
TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG
GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY
VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE
QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT
LDTTPLPDNKKDIHNSFINVGVNRTDANAKSDPYVQLHHHDEYSEAVEQAQETDTVQASD
LPHSYQKKDSHNNNNNNNMPGGPIINIKVIMALLCLITFMVGFI
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatactcataccgctttactgcttcgtatatatcatagtctcgctctcacacactgca
tacgcttgggctccatcaaacagctatgccccatcatacatggactgtaagcaagccctg
gggtccgctttcaacgaggacttctccctcataagagaggcagactccatctcccacaac
gagtccctctggctacagaaaagaatgcaaaacacaagagaaccattgcttcaattccta
aatagatctctaacatccctcaacacatcctcttctttcgacaccgctgcattactatcg
tccctaatgggctccgattcagcatcacaaccaaagatagggatcgctgtctctggtggt
ggttatagatccatgctcacaggcgctggtatcctcgccgcaatggataatagaacaaga
ggcgctcaacatcatggtctgggcggtttgttacaatcaactacatatttaagtggtgct
tcggggggtaactggttggttggtaccctggcttataataactggacctctgtacagtcc
atcattgataattttaatgaatctgattccatttgggatttatctgaatcaatagtctca
ccaggtgggaaaaatattttcaaatcagcaagaagatgggatcacatctcggatgctcta
caggataaacaaaaggccgggtttgatacctcgctggccgacgtttggggaagagcacta
tcttataaattcttcccatctttgtatagaggtggggtcgcatatacttggtcttcttta
agggattcccccgttttcacagagggtcaaatgcccttccccatttcagtggctgatgga
agatacccaggttccaaagtcttgaatttgaatgctactgtgtttgaattcaaccctttt
gaaatgggatcttgggatccttcattgaacactttcactgatgtcaaattcttgggtaca
aatgtatctgctgggaaacccattgattcacaaagatgtgtccagggatttgataatact
gccttcattatgggtacttcatctacacttttcaatcaatttttattaagaataaattct
acaaatttacatttaccaggattcattacaaaattggcaacacatttcttaaaggatatt
tcacaagattttaatgacgtcgctacatatcatccaaatccatttaaagatgcaaatttc
atcgacgcaaactatacaaagagtatcgttaattcaaaatcattatatctagtggatgga
ggtgaagatgatgaaaatatcccattattacccctaattcaacgtgaaagagatttggat
atagtattcgccatcgataactcaatggatatgaaattggcatggccagatgggtcctcc
ctagtacacacttttgaaagacaatttgttagacagggacaaggaatggctttcccctac
gttccaggtactgacacttttgtcaatttaggattaaatcaaaaaccaacatttttcggt
tgtgacgctcataatttgacagatttggaatacatccctcccttggtcatctatttacca
aataaacaatattcattcccaagtaatcaaagtgcgttcaaattatcatacacagaagaa
caaagaagagctatgatctccaatgggttcgaaatagcaacaagaaataacttcacagat
gatcctgatttcttaggatgtatcggttgtgccatcattagaagaaagcaacaatctttg
aatttaaccttacctgaaggttgtaacacttgtttcaccaattattgttggaatggaaca
ttggacaccactccattacccgataacaagaaggatatccataattctttcattaatgtt
ggggtcaatagaacggatgctaatgccaaatctgacccctacgtccaattgcatcatcat
gatgaatattctgaagctgtcgaacaagctcaagaaactgatactgttcaagcttctgac
ttacctcattcgtaccagaagaaagactctcataataacaacaacaataataacatgcca
ggtggaccaataattaatattaaagtcattatggctttactatgtctaattacattcatg
gtcgggttcatataa

DBGET integrated database retrieval system