KEGG   Naumovozyma castellii: NCAS_0D02230Help
Entry
NCAS_0D02230      CDS       T02233                                 

Gene name
NCAS0D02230
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ncs  Naumovozyma castellii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NCAS_0D02230 (NCAS0D02230)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NCAS_0D02230 (NCAS0D02230)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     NCAS_0D02230 (NCAS0D02230)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:415794..418367
Genome map
AA seq 857 aa AA seqDB search
MRSDEIVTVNKKCTINIQEEKTDETYGIRKNIRTIIRRTSDLVSSGELPNEIGPLTYSNL
ITDDITEYFKSDTTISAKLSTLCNQLKSKGIIMKKITRRKQRLYLFKLGPTLQTITWKNE
TKTISLDSIKDIRIGEMASNYREEYGIEEQFSGLWLTLIYNISKNKLKTLHLLARDAVEF
NAFFNCIYGLVKSRRELMESISVPNNEQFANIHWHHTVSERKEDENNDTLSFEDVRRLCE
KFHIYCSSAYLLKFFKLADVNHNSLLNFQEFQTFVKLLKQRQEISTIWTGLTEGKLKMDL
QMFTEFLTNVQGESSTDMQIQDLFIEFSMANKGEYLTEEGFTKYLNSQPYLIELKEDYSK
PLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDGDDGPVVCHGFLTP
SIPLRNVLGAIRKYAFITSSYPLIISLELNCDKMNQKLASMVIKDTLGHMLYVDHGDSLS
LPSPQELRHKIIIKAKKTKIRLGSRSPFSSSPIETTSSISSSYDSEFDSSSNAANPGVAT
INTETLKRRNSSSSITRIRRIGLKHNIKIIADVLEISGIHGIKFRDFSLPESKTCTHCFS
INEKKFDSIRLDNSLNLSLDKHNRRYLMRIYPHALRYKSTNFNPIKFWSLGSQMVATNWQ
TNDLGQQINLAMFQFSNQRNTIFHSGYVLKPLALLSTVSKEKHIPALYEKLNKLTPLKKV
IIKILSAQLLPNSKEVKNTTNKEENFGSSVLMEYISNDDLLDLHIVKNGIRTSTGEVRTI
QCKENGFNPIWDSELQMLIRHLDFAFIRFTVIANGIPLATSCLKLSYLRRGYRHIPLYSM
EGEQYIFSKLFIYTTIT
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggatgaaatagtaacagtgaataaaaaatgcacaataaacatccaagaggag
aaaaccgatgaaacttatggtattaggaaaaatatcaggaccatcataagaagaacttct
gatttggtatcctccggagaactaccaaatgagattggaccattgacctattcaaacttg
ataacagatgatattaccgagtactttaaaagcgacacgacgatatcggctaaattgtcc
actttgtgtaatcaattgaagtcgaaaggtatcataatgaagaagattacgagacggaaa
caaagactataccttttcaagttaggaccaactttacaaactataacgtggaaaaatgaa
actaaaactatcagcttggactcaatcaaagatattagaattggagagatggccagtaat
tatagagaagaatacggtattgaagaacagttttctggattatggctcacccttatctat
aacatttccaaaaataaattgaaaaccttacatttactggccagagatgctgttgaattt
aatgcatttttcaattgtatttacgggttggtgaaatcgagaagagagctgatggaaagt
atatctgtgccaaacaacgagcaatttgcaaatattcattggcatcatacggtatctgag
aggaaagaagacgaaaataatgatacattatcatttgaagatgttagaagattatgtgag
aagtttcatatttattgctcttccgcttacctgctcaaattcttcaaactcgccgatgtt
aatcataatagcttactgaacttccaagaattccaaacttttgttaaattattaaaacag
cgtcaggagatttctacaatctggactggcttaacggagggaaagttaaagatggattta
caaatgtttactgaattcctcacaaatgttcaaggagaatcgtcaacggatatgcaaatt
caagatttatttatcgaatttagtatggcaaataaaggagaatatctcactgaagagggt
ttcacgaaatatttgaactctcagccatatctaattgagttgaaggaagattatagcaag
ccactaaaccattactttattgcgtcatctcataacacatatttattggggaagcagatt
gctgaaacaccctcagtggaaggatacattcaagttttacaacaaggatgtcgctgtgtg
gaaattgatatttgggatggtgatgatggacctgtggtatgtcatggatttttgactcca
tctattccattgcgtaatgtgctcggagccattcgaaaatatgcatttatcacatcttca
tatccattgatcatttctttggaattgaattgtgataagatgaaccagaaactggcaagt
atggtaatcaaagatactctaggacatatgttatatgtagatcatggagatagtttgtcg
ttgccgtcaccacaggaattaaggcacaaaatcattatcaaagccaaaaagactaagatt
cgtctaggtagtcgaagtccgttctcatcctcccctatagagactacttcatcaatcagt
tcttcatatgattcagaatttgatagtagttccaacgctgccaatcctggtgttgccacc
atcaataccgaaactctcaaaagaagaaattcaagtagttccattactcgaatacgaaga
atcggtctaaaacataatattaagataatagcggatgtgttggaaatatcaggtattcat
ggcattaagtttagagatttttcacttcctgaatcaaaaacatgcacacattgtttctcg
attaatgaaaagaagtttgactccatacgtttagataattctttgaacctttcgcttgat
aagcataatagacgatatttaatgagaatttatccacatgcattaagatataaatcaaca
aatttcaatcccatcaaattttggtccttaggtagtcagatggtagctacgaattggcaa
actaatgaccttggccaacaaattaatttggcaatgttccagtttagtaatcaaaggaat
actattttccattcgggatatgttttaaaaccacttgctctactatctacagtatcaaaa
gagaagcacattccggccctgtatgaaaaattgaataagcttactccgttaaagaaggtt
atcatcaagatcttatctgcacagttactacccaactcaaaagaagttaaaaacactacg
aataaggaagagaattttgggtcgtcagtgttgatggagtacatcagtaatgatgactta
ttggatctacacattgtaaaaaatggaattaggacatccaccggagaagtacgtacaatt
caatgcaaagagaacgggtttaatcccatatgggactcagagcttcaaatgttaataaga
cacttagactttgcctttatccgtttcacagtgattgccaatgggattcccctggctaca
tcctgtttaaaattaagttatttacggagaggctacagacacatccccttgtatagcatg
gagggggaacaatatatattttccaagttgttcatctacacgactatcacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system