KEGG   Naumovozyma castellii: NCAS_0D02230Help
Entry
NCAS_0D02230      CDS       T02233                                 

Gene name
NCAS0D02230
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ncs  Naumovozyma castellii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ncs00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ncs04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:415794..418367
Genome map
AA seq 857 aa AA seqDB search
MRSDEIVTVNKKCTINIQEEKTDETYGIRKNIRTIIRRTSDLVSSGELPNEIGPLTYSNL
ITDDITEYFKSDTTISAKLSTLCNQLKSKGIIMKKITRRKQRLYLFKLGPTLQTITWKNE
TKTISLDSIKDIRIGEMASNYREEYGIEEQFSGLWLTLIYNISKNKLKTLHLLARDAVEF
NAFFNCIYGLVKSRRELMESISVPNNEQFANIHWHHTVSERKEDENNDTLSFEDVRRLCE
KFHIYCSSAYLLKFFKLADVNHNSLLNFQEFQTFVKLLKQRQEISTIWTGLTEGKLKMDL
QMFTEFLTNVQGESSTDMQIQDLFIEFSMANKGEYLTEEGFTKYLNSQPYLIELKEDYSK
PLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDGDDGPVVCHGFLTP
SIPLRNVLGAIRKYAFITSSYPLIISLELNCDKMNQKLASMVIKDTLGHMLYVDHGDSLS
LPSPQELRHKIIIKAKKTKIRLGSRSPFSSSPIETTSSISSSYDSEFDSSSNAANPGVAT
INTETLKRRNSSSSITRIRRIGLKHNIKIIADVLEISGIHGIKFRDFSLPESKTCTHCFS
INEKKFDSIRLDNSLNLSLDKHNRRYLMRIYPHALRYKSTNFNPIKFWSLGSQMVATNWQ
TNDLGQQINLAMFQFSNQRNTIFHSGYVLKPLALLSTVSKEKHIPALYEKLNKLTPLKKV
IIKILSAQLLPNSKEVKNTTNKEENFGSSVLMEYISNDDLLDLHIVKNGIRTSTGEVRTI
QCKENGFNPIWDSELQMLIRHLDFAFIRFTVIANGIPLATSCLKLSYLRRGYRHIPLYSM
EGEQYIFSKLFIYTTIT
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggatgaaatagtaacagtgaataaaaaatgcacaataaacatccaagaggag
aaaaccgatgaaacttatggtattaggaaaaatatcaggaccatcataagaagaacttct
gatttggtatcctccggagaactaccaaatgagattggaccattgacctattcaaacttg
ataacagatgatattaccgagtactttaaaagcgacacgacgatatcggctaaattgtcc
actttgtgtaatcaattgaagtcgaaaggtatcataatgaagaagattacgagacggaaa
caaagactataccttttcaagttaggaccaactttacaaactataacgtggaaaaatgaa
actaaaactatcagcttggactcaatcaaagatattagaattggagagatggccagtaat
tatagagaagaatacggtattgaagaacagttttctggattatggctcacccttatctat
aacatttccaaaaataaattgaaaaccttacatttactggccagagatgctgttgaattt
aatgcatttttcaattgtatttacgggttggtgaaatcgagaagagagctgatggaaagt
atatctgtgccaaacaacgagcaatttgcaaatattcattggcatcatacggtatctgag
aggaaagaagacgaaaataatgatacattatcatttgaagatgttagaagattatgtgag
aagtttcatatttattgctcttccgcttacctgctcaaattcttcaaactcgccgatgtt
aatcataatagcttactgaacttccaagaattccaaacttttgttaaattattaaaacag
cgtcaggagatttctacaatctggactggcttaacggagggaaagttaaagatggattta
caaatgtttactgaattcctcacaaatgttcaaggagaatcgtcaacggatatgcaaatt
caagatttatttatcgaatttagtatggcaaataaaggagaatatctcactgaagagggt
ttcacgaaatatttgaactctcagccatatctaattgagttgaaggaagattatagcaag
ccactaaaccattactttattgcgtcatctcataacacatatttattggggaagcagatt
gctgaaacaccctcagtggaaggatacattcaagttttacaacaaggatgtcgctgtgtg
gaaattgatatttgggatggtgatgatggacctgtggtatgtcatggatttttgactcca
tctattccattgcgtaatgtgctcggagccattcgaaaatatgcatttatcacatcttca
tatccattgatcatttctttggaattgaattgtgataagatgaaccagaaactggcaagt
atggtaatcaaagatactctaggacatatgttatatgtagatcatggagatagtttgtcg
ttgccgtcaccacaggaattaaggcacaaaatcattatcaaagccaaaaagactaagatt
cgtctaggtagtcgaagtccgttctcatcctcccctatagagactacttcatcaatcagt
tcttcatatgattcagaatttgatagtagttccaacgctgccaatcctggtgttgccacc
atcaataccgaaactctcaaaagaagaaattcaagtagttccattactcgaatacgaaga
atcggtctaaaacataatattaagataatagcggatgtgttggaaatatcaggtattcat
ggcattaagtttagagatttttcacttcctgaatcaaaaacatgcacacattgtttctcg
attaatgaaaagaagtttgactccatacgtttagataattctttgaacctttcgcttgat
aagcataatagacgatatttaatgagaatttatccacatgcattaagatataaatcaaca
aatttcaatcccatcaaattttggtccttaggtagtcagatggtagctacgaattggcaa
actaatgaccttggccaacaaattaatttggcaatgttccagtttagtaatcaaaggaat
actattttccattcgggatatgttttaaaaccacttgctctactatctacagtatcaaaa
gagaagcacattccggccctgtatgaaaaattgaataagcttactccgttaaagaaggtt
atcatcaagatcttatctgcacagttactacccaactcaaaagaagttaaaaacactacg
aataaggaagagaattttgggtcgtcagtgttgatggagtacatcagtaatgatgactta
ttggatctacacattgtaaaaaatggaattaggacatccaccggagaagtacgtacaatt
caatgcaaagagaacgggtttaatcccatatgggactcagagcttcaaatgttaataaga
cacttagactttgcctttatccgtttcacagtgattgccaatgggattcccctggctaca
tcctgtttaaaattaagttatttacggagaggctacagacacatccccttgtatagcatg
gagggggaacaatatatattttccaagttgttcatctacacgactatcacataa

DBGET integrated database retrieval system