KEGG   Naumovozyma castellii: NCAS_0D02390Help
Entry
NCAS_0D02390      CDS       T02233                                 

Gene name
NCAS0D02390
Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NCAS_0D02390 (NCAS0D02390)
Peptidases [BR:ncs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCAS_0D02390 (NCAS0D02390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(451930..455565)
Genome map
AA seq 1211 aa AA seqDB search
MSTPTEVYGSIINTVDLGKRSEKILPSLNSSSDEELEVLVEDSFTWHIDDWFSLTGPKYA
SPRVKIGDFEWDLLLFPQGNHNKGLAVYVEPHPKERRNEETGLMEAVDPNWYCCAQFAVC
LSRPEEDSEINLVNKSHHRFDSADTDWGFANLIDLNHLKYPSKNYSLSFLKDGQLNVTVY
VRILKDPTGVLWHNFVNYDSKKVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIPT
ENESPNDSVPLALQRAFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRL
ENRMKGTPVEGKLNELFVGKMKSYIKCINVDYESSRVEDFWDLQLNVKNLKGLEESFKNY
IEIELMNGENQYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEF
PESIDVSPYMDKKALRENKESCKYTLHGVLVHTGDISTGHYYAMIKPDLQDQWYRFDDEK
VWKVTKKQVFEENFGMNKLPEEEIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEVLQP
VSETDVPSYVVTRVEKETQERVEREKEIREAHLFLRLNIHSMKNFINYEGFDISSVDNAA
GFLSEDLNDGSEQPLSLKLARTTTLKEFYKLLKESLKIHSEREIKYWKMEYRKNNTLRIA
EPIPVLDENTSLEEALEITKDMKFSSLNIFVEEPYLELHYLHKLKEENLLKSAVLTEELI
HYLRNNIEEIVAKEDIPKPTENLTGSQVFLLLKKFDPLLQRLVGFCHCIMGQTDLISEIG
QLTADILDTKSEIQFFEEISAPALEKIHSSEKLYSAELRTGDILSFQTPDVNLTAEFPTY
KHIEEFYEFLRHRVKLRFTRAEENSEEYVLESKDNKSFEFWISAYAPYDEVAKLVSTYAQ
VDPDHLKIFAVYANGRFPLKSKCVLNDYLIKDYNCESIPPFEYEILSISLKELEQLRPIK
FYWLKDSYIHYQSFEFEVSNTFTIRQFLEKIQNKIGFSDQDKDNILIWTNSRFEFQNILV
ETTIFKDIEKGTFLFGRVLPEEVRLFREITAITDKYSQIREQNEEAGEEDDLSSINDDVN
EDAITNSAEEKEILELPGRLIIVSQYFKEPQNRHGISFLFTLLPDEPFTETRKRLHERFG
LGQKEFAKIKLAISFKAPNGPVFKGLQNYTDNDLEKLCLFNILNNLDYIYMDHPDRLRSH
SSYDRPMVIKN
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccctactgaagtgtacggatccattataaatactgttgacctgggcaaacgt
tcagagaagattcttccttcgttaaattcgtctagtgatgaagaactagaagttctggtg
gaagattcttttacatggcacattgacgattggttcagtctcaccggtcctaaatatgct
tcacctagagtaaagattggggattttgaatgggatttgttattattcccccaaggaaat
cataataaaggtttggcagtatacgtggaaccgcatccaaaagagagaagaaacgaagaa
actgggctaatggaggcagttgatccaaattggtactgttgtgctcaatttgctgtgtgt
ttgtctagaccagaggaggatagtgaaattaacctggtgaataaatcccaccaccgcttc
gatagtgcagatacagattggggtttcgcgaatctcattgatttgaaccatttaaagtat
ccatcaaagaattattcattgagttttcttaaggatggtcaactaaatgtgacagtgtat
gtccgaatcttgaaagaccctactggagtgttgtggcataactttgttaattacgattcg
aaaaaagtgacaggttacgtagggtttagaaatcagggtgctacatgttacttaaattca
ttgttgcaatcatatttctttacgaagtactttagaaagttagtctatcagatcccaacc
gaaaatgaaagtccaaatgacagtgtcccattagcattacaacgagcattttatcagtta
caagtttcagatattccgttagatactttggaactaacaagatcttttggttgggatagc
gctgaagcgtttactcaacatgatgtccaagaattaaaccgtatcttaatggataggtta
gaaaatagaatgaaaggtacacccgttgaaggaaaattgaatgaattatttgttgggaaa
atgaaaagttacattaaatgtataaatgttgattatgaatcttccagagtggaagatttt
tgggatttgcaattgaatgtaaaaaatttgaaaggcttagaggagtcgtttaagaactac
attgaaattgagctaatgaatggtgagaatcaatatgcagctcaagatttcgggttgcaa
gatgctgaaaagggtgttatctttgaatccttccctcctatcttacatttacaattgaag
agatttgaatatgatttcaattatgaccaattaataaaaatcaatgatcgttatgagttc
ccagaatcaatcgacgtttcaccctatatggataagaaagcattacgtgaaaataaagaa
tcgtgtaaatatacattacatggtgttctagtgcatacaggtgatatttccactgggcat
tattatgcaatgataaaaccagaccttcaggatcaatggtatagatttgatgatgagaag
gtttggaaggtaacaaaaaaacaggtatttgaagaaaattttggtatgaacaagttgcct
gaagaagaaattcgtggtatgacgagagagcaataccaaaattacctaatcacccgtcat
accagtgcatatatgcttgtatatataagagaggacaaagaaccggaagtactacaacca
gtctcagagactgatgttccatcttacgtggtcacacgagtggagaaagaaacacaagaa
agagttgaaagagaaaaagaaatccgagaagctcatttattcttaaggttgaatatacat
tcaatgaaaaattttataaattatgaagggtttgatatttcttcagtggataatgcagca
ggattcttgagtgaagatctcaatgacggaagtgagcaaccattatctttgaaattagca
cgaaccacaactctgaaagagttttataagttacttaaggaaagtctaaaaattcactcg
gaaagagagatcaagtattggaaaatggagtatcgcaaaaacaacactttgagaattgct
gagccaatcccggtgttggatgaaaacacatccctagaggaggccctagagattacaaaa
gatatgaagttttcttctttgaacatatttgtggaagaaccatacctagaactacattat
ttgcataaattgaaagaggaaaacctattaaaatccgctgtattaactgaagaactaatc
cactacttgaggaataatattgaagagattgttgcaaaggaggacattccgaaaccgact
gaaaaccttacaggttctcaagtattcctacttttaaagaaatttgacccgctgttacaa
cggttggttggtttctgtcactgtattatgggtcagaccgatcttatttctgaaattggc
cagcttacagcagatatattggacactaaatcagagatacagttttttgaagagatatct
gccccagctcttgaaaagatacactcctcagagaaattatattcagctgagttgagaact
ggtgatattctgtcgttccaaactccagatgttaacttaacagctgaatttccaacatac
aagcatattgaagagttttatgaatttttaagacatcgtgtaaagttaagatttactaga
gcagaagaaaatagtgaggaatatgtcctagaaagcaaggataataaatcctttgagttt
tggatatccgcatatgccccttatgatgaggtggccaaactggtttcgacctatgctcaa
gttgatcctgatcatctaaaaatatttgctgtctatgcaaatggaagattccccttgaaa
tccaaatgtgtattgaatgactatttaatcaaagattacaattgcgaatcaattcctcct
tttgaatatgagattttgtctatatcactaaaggaattagaacaactaagaccaatcaaa
ttttattggttgaaagatagttatattcattatcaaagttttgaatttgaagtttcaaac
actttcactataagacaatttctagaaaagattcaaaataaaattggctttagtgatcag
gataaggacaatatactgatttggaccaattccaggtttgaattccaaaacattttagtt
gagacgaccattttcaaagacattgaaaagggcacttttctctttggtagggttctgcca
gaggaagtacgtctgttcagagaaattacagctattaccgataaatatagccaaattaga
gagcaaaacgaagaagctggagaggaggacgatctttcatcgatcaatgatgatgttaat
gaagatgcaataacaaactcagctgaggaaaaggagattttggaacttccgggcagatta
attattgttagccaatacttcaaagaaccacaaaacaggcacggtatttcgttcttgttc
actttattaccggatgaaccattcactgaaacaagaaaacgtcttcatgaaagatttggc
cttggtcaaaaggaatttgccaaaattaaattagcaatttcattcaaggcacccaatggt
cctgttttcaaaggcttacaaaactataccgataatgatcttgaaaaactttgtctgttc
aatattttgaacaatttagattatatctacatggatcatcctgatagactaagatcccac
agttcttatgatagacccatggtcattaaaaattaa

DBGET integrated database retrieval system