KEGG   Naumovozyma castellii: NCAS_0D03250Help
Entry
NCAS_0D03250      CDS       T02233                                 

Gene name
NCAS0D03250
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ncs  Naumovozyma castellii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ncs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ncs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:608476..609969
Genome map
AA seq 497 aa AA seqDB search
MAPQITTRSSVEVATTPVLSNDIETVDLIEANIVASGANKKTVRVVNGLGSLMGSKEITQ
LDDSITAKVQPSTTTSGEKLHISEQPWTLNNWHQHINWLNMVLTVFIPAIGFYFALSGKV
PVRKNVVLFALFYYVASGITITAGYHRLWSHRAFEARWPLRLFFAILGAANVQGSIKWWG
HSHRIHHRYTDTPRDPYDARRGLWYSHMGWMLMKPNPKYKARADISDLNDDWIVRFQHRH
YIPIMILTAFVFPTWVVGKYISPGDYMAGFIYAGILRVFAIQQATFCINSLAHFLGDQPF
DDKRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKLFIYATSILGLALNL
KTFDANVIQQGIVQQQEKKVNKMKNKLHWGPTLDELPVWDKKEFVEQAQLNKNLVVISGI
IHDISNYIPEHPGGESLIKQALGKDATRAFQGGVYRHSTAAQNVLSELRVAVLKENGNAA
MNFVKRRGEQFDKNKFE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctccacagataacaactagatcctccgtggaggtagcaaccaccccggtcctatca
aatgacatagaaactgtagatcttatcgaggctaacatcgtcgcttcaggtgccaacaag
aaaacagtccgtgtagtcaacggtcttgggtcccttatgggatctaaggaaattacacaa
ttagacgactctataacagcaaaggttcaaccttctacaacgacatctggggaaaaatta
cacatatccgaacaaccatggactcttaataactggcatcaacacataaattggcttaac
atggtcctcacagtgtttatcccagctattggattctatttcgctctatcaggtaaagta
ccagtaaggaaaaatgtggtactatttgccctcttttattacgtcgcttctggtattaca
atcactgccgggtatcatcgtctatggtctcatcgtgcattcgaagcacgttggccatta
cgtctattcttcgccatattaggtgccgctaacgtacaaggttccattaaatggtgggga
cattcacatagaatccatcatcgttacacagatactccccgtgatccctacgatgctcgt
cgtggtctatggtattctcatatgggttggatgttaatgaaaccaaacccaaaatataag
gctcgtgcggatatatctgacttgaacgacgattggattgttagattccaacatagacat
tatattccaattatgattctcactgcattcgtattccccacttgggtcgtcggcaaatat
atctcacctggagattacatggcagggttcatctatgcaggaattcttagagtattcgcc
attcaacaagcaactttctgtattaattcattggctcatttcctgggagatcaaccattc
gatgataagagaaccccaagggataattggattaccgctttggtcacgttcggtgaagga
taccataatttccatcatgaattccccactgattatagaaacgctatcaaatggtatcaa
tatgatccaacaaaattattcatttatgctacttccatattgggtcttgccctaaatttg
aaaacttttgatgcaaatgtcattcaacaggggatagtacaacaacaagaaaagaaagtc
aataaaatgaagaataaattacattggggccccactttggatgaattaccagtttgggat
aagaaggaattcgtcgaacaagcacaactcaataagaatctagtggtcatctcagggata
attcatgacatatcaaattatattccagaacatccaggtggggaatctttgattaagcaa
gccttgggtaaagatgcaacaagagcattccaaggtggtgtctaccgtcattccaccgcg
gcacaaaacgtattatctgaattgagagttgctgttttgaaggaaaacgggaatgccgct
atgaattttgtcaagagaagaggtgaacaatttgacaagaataagtttgaatga

DBGET integrated database retrieval system