KEGG   Naumovozyma castellii: NCAS_0D04380Help
Entry
NCAS_0D04380      CDS       T02233                                 

Gene name
NCAS0D04380
Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ncs  Naumovozyma castellii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ncs01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncs00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ncs00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ncs00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(828981..835676)
Genome map
AA seq 2231 aa AA seqDB search
MSEENLFEETTSKKQYEITDYSSKHKRLPGHFLGLNTIEKAEESPLKNFVRSHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPEDLEANAEYIRMADQYVEVP
GGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFIGPPGSAM
RSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCSSPEDGLE
KAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLAGKARHLE
VQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSAVRLGKLVGYVS
AGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMGIPMHRISDIRV
FYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFKPSGGSLHELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLISHKMTAEKPDPTLAVICGATTQTFIAAEAARKKY
IDNLKRGQVPPKSQLETMFPVEFIHEGMRYKFTVAKSADDRYTLFINGSKCEVRASKLSD
GGLLIALGGKSHTIYWKQEVGATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVESGD
HIAAGQPYAEIEVMKMQMPLVAQETGIIQLLKQPGSTLSAGDIIAILTLDDPSKVKHALP
FEGLLPDFGSPVVEGTKPAYKFKSLISTLQNILQGYDNQIIMNASVQQLIEVLRDPKLPY
SEWKLHISALHSRLPIDLYERLEELVSRSAKRAAIFPARQLNKMLEGALKQPDADSQLAG
NIEPLLDITRRYMDGLEAHEHSVFVNFLEEYYNIEKLFNGSNVREENVILKLRDENIDNL
DKVALIVLSHAKVSAKNNLILAILKHYQPLCKISSEIAHIFTKPLQDLVQLESKSTAKIA
LQAREILIQGALPSVKERTEQVEHILKSSVVQTSYGASNAKRSEPDLEILKDLIDSNYVV
FDVLIGFLSHPDPAVAAAAAQVYVRRAYRAYTVGEVKGHESISNPVIEWKFQLPSAAFSS
IPQVRTKMGMNRAISVSDLSYVVDSEHSPLRTGILVSANHLDDVDNNLAESLEVIPEHFS
PSGPVPDRSGSSSTLSNVANIFVGSTEGFESETEILKKIREILDVNKPDLIKSAIRRITF
MFGFKDGTYPKYYTFNGPNYCENETIRHIEPALAFQLELGKMSNFNIKPIFTENRNIHVY
EAVSKTSPLDKRFFTRGIIRTGRIREDISIQKYLTSEANRLMSDILDNLEIIDTSNSDLN
HIFINFSAVFDVSPEDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIQDPQTGAPVPLRAL
INNVSGYVVKSELYTEVKNSKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKAHLM
GTTYVYDFPELFHQATVSQWEKHSPETKLTDSFFTANELIEDENGELTEVEREPGANSIG
MVAFKVTVKTPEYPRGRQFVIVANDITFKIGSFGPQEDDFFNKVTEYARKRGIPRIYLAA
NSGARIGIAEEIVPLFQVCWKEEGNPSKGFEYLYLTSEGLETLKKYGKENSVVTERVVEN
GQERFVIKTIIGAEDGLGVECLRGSGLIAGATSRAYQDIFTITLVTCRSVGIGAYLVRLG
QRAIQIEGQPIILTGAPAINKVLGREVYSSNLQLGGTQIMYNNGVSHLTAPDDLAAVEQI
MNWLSYIPAKRNMPVPILENDDKWDRLVDFVPQPKVAYDVRWMLEGRDMEDGSFEYGLFD
KGSFFETLSGWAQGVVVGRARLGGIPLGVIAVETRTVENLIPADPANPESQESLIQEAGQ
VWYPNSAFKTAQAIQDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPIFIYIPPTGELRGGSWVVVDPTINSDQMEMYADKDSRAGVLEPEGMVGIKYRREKLLG
TMNRLDPAYKSLREQLSNKDLNVDEHKEISKKLALREKLLLPIYNQISIQFADLHDRSER
MVSKGVISKELEWVESRRFFFWRLRRRLNEEYLIRRLDNELVDASRLEKIARLRSWYPAS
VNHEDNRQVATWIEENYQILDEHLKSLKMEAFAQGLAKSIRNDHDNVINGLSEVLKMLSN
EDKEKLLKTLK
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaaacttattcgaggaaacaacctccaaaaagcaatacgaaataactgac
tattcatccaaacataagagactcccaggtcatttcctaggtctaaatacaatagagaag
gctgaagaatctccattgaaaaatttcgtcagatcacatggtggtcacaccgtcatctcc
aagatattaatcgctaataatgggattgctgccgttaaggagatccgttccgttagaaaa
tgggcctatgaaactttcggtaatgaaagaaccattcaattcgtcgctatggccacccca
gaagatttggaagctaatgctgaatacattagaatggccgatcaatacgtggaagtccca
ggtggaaccaacaataaaaattatgctaatgtcgatctgatcgtggacattgcagaaaga
gctgatgtcgatgcagtgtgggcaggttggggtcatgcctctgaaaacccacatttacca
gaaaaattagccatgtccaagaggaaagtcgtctttattggtccaccagggagcgctatg
agatccctaggtgacaagatttcctctaccattgtcgctcaatccgctcacgttccatgt
atcccatggtcaggaacaggtattgacaaagttcaagtggataaagatactgggttggtc
tccgtcgctgatgaagtatacgctcaagggtgctgttcatcccccgaggatggacttgag
aaggccaagaaaattgggttccccgtcatgattaaggcctctgaaggtggtggtgggaaa
ggtattagacaagtggaacgtgaagaagatttcatcgctttgtaccatcaagctgccaat
gaaattccaggttcccccatatttattatgaaattggcaggtaaagcccgtcatttggaa
gtgcaattattagctgaccaatatggtaacaacatttctctatttggtcgtgattgttcc
gtgcaaagacgtcatcaaaaaattattgaagaagctccagtgaccattgctgcaccagaa
acttttgccatgatggaaaaatctgccgtgagactggggaaattggttggttatgtgtcc
gctggtactgtggagtatttatactctcatgaagataagaaattttatttcttagaattg
aatccaagattacaagtcgagcatccaaccactgaaatggtcacaggtgtaaatttacca
gccactcaattgcaaattgctatgggtatccccatgcatagaattagcgacattagagta
ttttacggaatgaacccacataccgcttcagaaattgatttcgatttctccacagaagaa
tcattgaagactcaaaggaaaccagttccaaagggtcattgtactgcctgtcgtattact
tctgaagatccagatgaagggtttaaaccatctggggggtccctacatgaattgaacttc
cgttcttcttcaaacgtttggggttacttctcagtgggtaataatggtggtattcattca
ttctcagattctcaattcggtcatatctttgcattcggagaaaatagacaagcctctaga
aaacatatggttgtcgccctaaaggaattatccattagaggtgatttcagaaccacagtg
gaatacttaatcaaattattagaaactgaagattttgaagataatacaattactaccggt
tggttggatgatttaatttctcataagatgactgctgaaaaaccagatccaacattggct
gtcatttgtggtgctaccactcaaacttttattgccgctgaagcagctcgtaagaaatat
atagataacttaaagagaggtcaagtaccaccaaagtctcaattggaaacaatgttcccc
gtggaattcattcatgaaggaatgagatacaaatttactgtggctaaatctgctgatgat
cgttacacattgttcattaacggttccaaatgtgaagttcgtgcctccaagttatcagac
ggtggattgttgattgctcttggtgggaagtcccataccatttattggaaacaagaagta
ggtgcaacaagattatccgttgattctatgactactttgttagaagtggaaaatgatcca
acacaattacgtactccttctccaggtaaattagtcaaattcttagtggaaagtggtgat
cacattgccgcaggtcaaccttatgctgaaattgaggttatgaaaatgcaaatgccccta
gtagctcaagaaactggtattattcaacttttgaaacaaccaggttctactctttctgca
ggtgatataattgccatcttaactctagatgatccatcaaaggttaaacacgcattgcca
tttgaaggtttattacctgattttggttctccagtggttgaaggtaccaagccagcctac
aaattcaaatctttaatttccaccttacaaaatatcttacaaggttatgataatcaaata
ataatgaatgcatcagtacaacaattaattgaggtgctaagagatccaaaattaccatat
tcagaatggaaattacatatttctgctctacattccagattacccattgatttatatgaa
agattagaagaacttgtcagtcgttctgctaagcgtgctgcaattttcccagctagacaa
ttgaataaaatgttagaaggtgctttgaaacaacctgatgcggatagtcaattggccggc
aacattgagcctttattggatataacgagacgttacatggatgggctagaagctcatgaa
cattcagtattcgttaactttttggaagaatattacaacattgaaaaactatttaatggt
tccaacgttcgtgaagaaaatgttatcttaaaactacgtgatgaaaacattgacaattta
gataaggtcgctttgattgttttgtcacatgctaaagtgtcagccaagaataatttgatt
ttagccattttaaagcactaccaacctttgtgtaagatttcttctgaaattgctcatatt
ttcactaagccattacaagatcttgtccaattggaatctaagtcaacagctaagattgct
ctacaagcaagagaaattttgatccaaggtgcccttccatctgtgaaggaaagaactgaa
caagtggaacatattttaaagtcttctgtagttcaaacttcctatggtgcatcaaatgct
aaacgctcagaacctgatctagaaattttgaaggatctaattgattctaactatgtagtt
tttgatgttttgattggtttcttaagtcatcctgatcctgccgtcgctgccgctgctgct
caagtgtacgttcgtcgtgcatacagagcatacactgttggtgaagttaagggtcatgaa
tctatttctaatccagtcattgaatggaaattccaattgccttctgctgccttttcctct
attccacaggttaggacgaaaatgggtatgaacagagctatctctgtttctgatttaagt
tacgttgttgacagcgaacattctccattaagaactggtattcttgtttctgctaaccat
cttgacgatgttgacaacaacctagctgaaagtttggaagtcattccagaacacttttct
ccatctgggcccgttcctgacagatctggtagttcatctacattaagcaatgttgctaac
atttttgttgggtcaactgaaggatttgagtctgaaacagaaattctaaagaagattaga
gaaatattagatgttaacaagccagacttaattaagtccgccattcgtcgtatcacattt
atgtttggttttaaggatggcacatatccaaaatattacacttttaatgggcctaattat
tgcgaaaatgaaacaatccgtcacattgaaccagctttagctttccaattagaattaggg
aagatgtccaacttcaacattaagccaatcttcactgaaaatagaaacattcatgtttac
gaagctgtcagtaagacttctccattggataagagatttttcacaagaggtataattaga
acaggccgtattcgtgaagatatctccattcaaaaatatttaacttctgaagccaataga
ttaatgagtgatatcttggataacttggaaatcatcgatacatccaattctgacttgaat
catatctttattaatttttccgccgtctttgatgtgtctccagaagatgttgaagccgcc
tttggtggattcttggaaagatttggtaaaagattattaagattacgtgtatcatcagct
gaaattcgtattattattcaagatccacaaactggtgcaccagtcccactacgtgcattg
attaacaatgtttcaggttacgtggtcaagtccgagttatacactgaagttaaaaacagt
aaaggtgagtgggttttcaagtctttgggtaaaccaggttccatgcatttgagacctatt
gccacaccatatccagtcaaagaatggttacaacctaaacgttacaaggcacatttaatg
ggtaccacttatgtttatgacttcccagaattattccatcaagctactgtatctcaatgg
gaaaagcattcaccagagacaaaattgacagattctttcttcaccgccaatgaattaatt
gaagatgaaaacggagaattaactgaagttgaaagagaaccaggtgccaattccattggt
atggttgcctttaaggttactgtaaagactccagaatatccacgtggtcgtcaatttgtt
attgttgccaatgatattacattcaaaattggttcctttggtccacaggaagatgatttc
tttaacaaggttactgaatatgctagaaagcgtggtattccaagaatctatttagctgct
aactccggtgccagaattggtatcgcagaagaaattgttcctttatttcaagtttgttgg
aaggaagagggcaatccatctaaggggttcgaatacttatatttgacatctgaaggacta
gagactttaaagaaatatggtaaggagaattctgtagttacagaacgtgttgtggaaaat
ggtcaagaaagatttgtcattaagacaattattggtgctgaagatggtctcggtgttgaa
tgtttgagaggatccgggttaattgccggtgccacctcaagagcataccaagatattttc
accattacattagttacctgtaggtccgttggtattggtgcttatctagtaagattgggt
caaagagccattcaaattgaagggcaaccaattatccttactggtgctccagccatcaat
aaagtgttaggtagagaagtttactcgtccaatcttcaacttggtggtacccaaattatg
tacaacaatggtgtttcccatctaactgctcctgatgatcttgctgctgtggaacaaata
atgaattggttgtcgtatattccagctaagcgtaacatgcccgttccaatcttagaaaac
gatgataaatgggacagattagttgattttgttcctcaaccaaaggttgcctacgatgtt
agatggatgcttgaaggtcgtgacatggaagatggtagtttcgaatatgggttatttgat
aagggatcctttttcgagacattatctggatgggctcaaggtgttgttgttggtagagct
cgtcttggtggtatccccttgggtgtcattgccgtggaaactagaaccgtggagaattta
attcctgctgatccagctaatcctgagtctcaagaaagtttgattcaagaagctggtcaa
gtttggtatccaaattctgcatttaagacagcacaggccattcaagatttcaatcatggt
gaacaattacccttgatgatcctggctaattggagagggttctctggtggtcaacgtgat
atgtacaatgaagttttgaaatatggttcatttattgttgatgcccttgtggattacaag
caacctattttcatttatattccacctactggtgaactaagaggtgggtcatgggttgtt
gttgatccaacgattaatagtgatcaaatggaaatgtatgctgataaggattcacgtgcc
ggtgttttagaacctgaaggtatggttggtatcaaatatcgtagagagaaactgttgggg
accatgaatagattagatcctgcatataaatcgttaagggaacaattatccaataaggat
ttgaatgtggatgaacataaggaaatttctaagaaattggcattacgtgagaaattacta
ctaccgatttacaatcaaattagtattcaatttgccgatttacatgatagatctgaacgt
atggtatctaagggtgtcattagtaaagaattagaatgggttgaatcgcgtcgtttcttc
ttctggagattaagaagaagattgaatgaagaatatttgattagaaggttagataatgaa
ttagtggatgcctctagattggaaaagattgctagattaagatcatggtatcctgcctca
gtgaatcatgaagataatagacaagtggccacatggattgaagaaaattatcaaatcttg
gatgaacatttgaaatctttgaagatggaagcatttgctcaaggattggctaaatctatt
agaaatgatcatgataatgtaattaatggattatctgaagtgttgaagatgttgtccaat
gaagataaagaaaaattattgaaaactttgaaatag

DBGET integrated database retrieval system