KEGG   Naumovozyma castellii: NCAS_0D04460Help
Entry
NCAS_0D04460      CDS       T02233                                 

Gene name
NCAS0D04460
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCAS_0D04460 (NCAS0D04460)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCAS_0D04460 (NCAS0D04460)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NCAS_0D04460 (NCAS0D04460)
Enzymes [BR:ncs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NCAS_0D04460 (NCAS0D04460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:847921..849462
Genome map
AA seq 513 aa AA seqDB search
MVTTSQVYRSTRSSDKATKTFEEAVIQGLASDGGLFIPPTIPQVSHETLFNKWSKLSFQE
LAFEIMRLYVDPQEIPDADLKELINRSYSTFRSDEVTPLVKNITGDKENLHILELFHGPT
YAFKDVALQFVGNLFEYFLQRTNKDLPEGQKKQITVVGATSGDTGSAAIYGLRGKKDVSV
FILYPTGRISPIQEEQMTTVPDKNVQTLSVKGTFDNCQDIVKAIFGDKEFNSKHNVGAVN
SINWARILAQITYYFYSYFKATNGTEGRVKFVVPSGNFGDILAGFFAKKMGLPVEKLVIA
TNENDILDRFLKSGTYERSDKVAVTLSPAMDILISSNFERLLWFLARDYLASNDDLKAGK
IVNDWFQQLKTEGKFQVDSVAIKGALSDFASERVSDSETSATIKKMYQESVNPKKYVLDP
HTAVGVCAAERLIAADKDSSINYISLSTAHPAKFADAVNKALSSFEGYSFEKDVLPAELK
KLSTLQKKLKFVERPDVELVKAAIEEELAKMDL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccacttcccaagtttatagatccaccagatcctcagacaaggctactaaaaca
ttcgaagaagccgttatccaaggtttggcttccgatggtggtttatttattcctccaacc
atcccacaagtctctcatgaaactttattcaataaatggagtaaattatctttccaagag
ttagcttttgagatcatgagactttacgtcgacccacaagaaatcccagatgcggactta
aaagaattgatcaacagatcttattctactttccgttccgatgaagtcacacctttagtt
aaaaacattactggtgataaagaaaatttacatatcttggaattgttccatggtccaact
tatgcattcaaggatgttgctctacaattcgtcggtaatttgttcgagtatttcttgcaa
agaactaacaaagatttaccagaaggccaaaaaaagcaaattactgttgttggtgctact
tcaggtgacactggttccgctgctatctatgggttaagaggtaagaaggatgtttctgtc
ttcatcttatatccaaccggtagaatctcaccaattcaagaagaacaaatgactactgtt
ccagataaaaatgttcaaactttatctgttaagggtactttcgataactgtcaagacatt
gttaaagctattttcggtgataaggaattcaattcaaagcataacgttggtgctgtgaat
tctatcaattgggcaagaattttagcacaaatcacatactatttctactcttacttcaaa
gctacaaatggtactgaaggtagagtgaaatttgttgtcccaagtggtaactttggtgat
attcttgccgggttcttcgccaagaagatgggtctaccagtggaaaaattagtaattgcc
accaatgaaaatgatattctggacagattcttaaaatctggaacctacgaaagatctgat
aaggttgccgttaccttgtcaccagctatggacattttaatttcttcaaatttcgaaaga
ttattatggttcttagcccgtgattatttagcatccaatgatgatttgaaggctggtaag
attgttaatgattggttccaacaattgaagaccgaaggcaagttccaagtcgactcggtt
gcgatcaaaggtgccttaagcgactttgcatctgaaagggtctctgactctgaaacttct
gccactatcaaaaagatgtaccaagaatctgtaaatccaaagaagtacgtgttggaccca
catactgctgtcggtgtctgtgctgctgaaagattaattgccgctgataaggattcttcc
ataaattatatttctttgtcgaccgctcatccagccaaattcgctgatgccgtcaacaag
gctttgtcatcctttgaaggttattcatttgaaaaagatgtgttaccagctgaattgaaa
aaattatcaactttacaaaagaaattgaaattcgttgaaagaccagatgttgaactagtc
aaggctgccattgaagaagaattagccaaaatggatttataa

DBGET integrated database retrieval system