KEGG   Naumovozyma castellii: NCAS_0D04890Help
Entry
NCAS_0D04890      CDS       T02233                                 

Gene name
NCAS0D04890
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ncs  Naumovozyma castellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCAS_0D04890 (NCAS0D04890)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCAS_0D04890 (NCAS0D04890)
   00630 Glyoxylate and dicarboxylate metabolism
    NCAS_0D04890 (NCAS0D04890)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCAS_0D04890 (NCAS0D04890)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:939854..941530
Genome map
AA seq 558 aa AA seqDB search
MVEINLKNVKLYADIDTTPQFLPSKTTVATILTRDALEFIVLLHRTFNAKRLELLGNREK
VQNELDSNKYSFDFLPEMENIRNDPTWQGAVPAPGLINRSSEITGPPLRNMLVNALNADV
TTYMTDFEDSSSPTWKNMIYGQVNLYDAIRNQINFSTTKKEYKLKNDISQLPTLIVRPRG
WHMVEKHLYVDDQPISASIFDFGLYFYHNAKELTKIGKGPYFYLPKMEHHLEAKLWNDIF
CVAQDFISMPRGTIRATALIETLPAAFQMEEFIYQLKQHSSGLNCGRWDYIFSTIKKLRN
KPNHVLPNRDQVVMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDVKANNEAMNK
VRNDKIREVTNGHDGSWVAHPALAQICNEVFSKMGTANQIYYIPETTVTASDLLNTNIQG
AQVTTESIRTNLDIGLQYMESWLRGSGCVPINHLMEDAATAEVSRCQLYQWVKHGVTLKD
TGEVVTPELTTKILNEETFKLASSSPVGKDNKFELASKYLLPEIRGEKFSDFLTTLLYDE
VVTCKDTPIDLNQLQRFQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaattaatttaaagaatgtcaagctatatgccgatattgataccaccccacaa
tttctaccttctaaaactacagttgctaccattttaactagagatgctttagagttcatc
gttttattgcatagaacctttaatgccaagcgtctcgagctattaggcaatagagaaaag
gtacaaaatgagttagattcaaacaagtattcatttgattttttgccagaaatggaaaat
atcagaaatgatccaacttggcaaggtgctgtccctgctcctgggttaatcaacagatcc
tcggaaatcactggtcctccattaaggaacatgctggtaaatgcattaaatgctgatgtc
accacttacatgaccgattttgaagactcctcatcacccacttggaagaatatgatatac
ggtcaagtgaatctttacgatgcaattaggaaccaaattaatttttctactacgaagaaa
gaatacaaattgaaaaatgatatatctcaattaccaactttaattgtaaggcctcgtgga
tggcatatggtcgagaagcatctatatgttgatgaccaaccaattagcgcatccattttt
gactttggcttgtacttctaccataatgccaaagaattaacaaaaattggcaaaggccct
tatttttatttaccaaagatggaacatcatttggaggccaagttatggaatgatatcttt
tgtgtagcacaggattttatttctatgccaaggggaaccatcagagctacagcgttaatt
gaaacattacctgctgctttccaaatggaagagtttatttaccaattaaaacaacattcc
agtgggttaaattgcggacgttgggattatatcttttctacaattaaaaaattaagaaat
aaacctaaccatgttctaccaaatagagatcaggttgtaatgacatctccattcatggat
gcatacgtaaagagattaattaatacatgtcatcgtcgtggtgttcatgccatgggtggt
atggccgcacaaattccaattaaggatgacgttaaggccaacaatgaggcaatgaataaa
gttcgtaatgataaaattagagaagtgactaatggccacgatggttcctgggtcgctcat
ccagcattggctcaaatttgcaatgaagtatttagtaaaatgggcactgctaatcaaata
tattacattcctgaaacaacagtgactgcttcggatctattaaataccaatatccaggga
gctcaggtaacaactgaaagcattagaactaatttagacatcgggttgcagtacatggaa
tcttggctaaggggatcaggatgtgtaccgattaatcacctaatggaagacgcagctact
gccgaagtttcacgatgccaactgtatcaatgggtaaaacatggtgtaactttgaaggat
actggagaagtagttactccagagttaactaccaaaattttaaatgaagagacatttaaa
ctggcatcaagtagtccagtaggtaaagataacaaatttgaattggctagcaagtatctt
ttacctgaaataagaggtgagaaattcagcgattttttaactactctattatatgatgaa
gttgtaacctgtaaggacactccgatagacctaaatcaattgcagcgttttcagtaa

DBGET integrated database retrieval system