KEGG   Naumovozyma castellii: NCAS_0E02490Help
Entry
NCAS_0E02490      CDS       T02233                                 

Gene name
NCAS0E02490
Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ncs  Naumovozyma castellii
Pathway
ncs04111  Cell cycle - yeast
ncs04113  Meiosis - yeast
ncs04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NCAS_0E02490 (NCAS0E02490)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0E02490 (NCAS0E02490)
   04113 Meiosis - yeast
    NCAS_0E02490 (NCAS0E02490)
Protein phosphatases and associated proteins [BR:ncs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NCAS_0E02490 (NCAS0E02490)
Ubiquitin system [BR:ncs04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     NCAS_0E02490 (NCAS0E02490)
Chromosome and associated proteins [BR:ncs03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    NCAS_0E02490 (NCAS0E02490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 ANAPC3 TPR_11 TPR_12 TPR_14 TPR_16 TPR_6 TPR_19 TPR_15 TPR_9 TPR_21 SRP_TPR_like ANAPC5
Motif
Other DBs
NCBI-GeneID: 11527235
NCBI-ProteinID: XP_003676678
UniProt: G0VFQ2
Position
5:complement(493779..496208)
Genome map
AA seq 809 aa AA seqDB search
MLFPPRSSTFDGKDSPKQQFQKTGPLEDDDLDSCIHLSQSSLGKLQDAIQTAIEQLNYDT
AEFLSELLHAHCCKPFEDANTITQRIAAAYLYSLSLFLNQKYTTAMEIAREESRKNIDVA
FIFGKCSLQVNTDTKLAIQSLIDLKSNINLNSNSNGTTATNATMNTCTTNLIHSPDMATI
DSLIAKLYYKLDRQHESALFHSEALNQNPYLWESYTELCSMKVKIDLRKLYKQTSSWSSS
SSSSSSSKIKKNTGYRKLRDSSAKAITDPSIIQYHKNKNSPYSKRFNSTPRKPTPFNLSV
PWYSSLSNESANPSPFGDQVSTTINNNNTSTNIGSNILQPNTIIGWPTNSNTHPNLRNNS
PITGTNNTSVLIKGNALTTSNSNSTATSSNNTASDETSSSNSPSMKQPTISSLAKVNTNS
RHRLLTTPPSKLNSTSNYKTPRNINNSNNSNNNLSSSMRKKLNLTSSNEETNTTSNNNNK
DSLNDILYIFALILKSASQFDSYKAIRLFDSKLPKQIKNNMPWCQAQLGKLHFEIVNYKT
SLKYFKKLRLLQPTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLF
SLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNA
YYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQ
IQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAI
KRYTIAMNLDPKGSNLISDALKKCHEQEE
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttccaccgcgcagctccacatttgatggaaaggacagccccaaacagcaattt
caaaagacaggacccttggaagatgatgatctggactcatgcatccatttatcgcagagt
tccctgggtaaattacaagatgcgatccaaactgccatagaacaattgaattatgatact
gccgagtttttatccgagttgctacatgcgcattgctgcaaaccattcgaggatgctaac
actatcacgcaaaggatagctgccgcttacttatattcactgtcattattcttgaatcaa
aaatatacaactgccatggaaattgctagggaagagagtcggaagaatatagatgttgcg
tttatttttggtaaatgttcattacaagtgaatacagatacaaagctggccattcagtca
ttgattgatttaaaatcaaacattaacttgaattctaatagtaatggtacgaccgcaacg
aacgccaccatgaatacttgcactacaaatctcatccattcaccagacatggcaaccata
gactctcttatagcgaaattatattataaactggatagacaacatgagagcgctttattt
cattcagaagctttaaatcaaaatccttatctttgggagtcctatacggaactgtgtagt
atgaaagtgaaaattgatttgaggaaactatataaacaaacttcttcctggtcgtcgtcg
tcatcatcatcatcatcttcaaagataaagaagaataccggttatcggaaactaagagat
tcatcggcaaaagcgataacagatccatctattatacaatatcataagaacaaaaattct
ccatattctaaacgattcaattctaccccaagaaagccaactccatttaatttgtctgtg
ccatggtattcctcattatctaacgaatcagcaaacccttccccatttggagaccaggta
tctacaacaattaataacaataatacttctactaatattggaagtaatattttacaacca
aacactataattggatggcctacaaattctaatactcatcccaatttgagaaataatagc
cccatcactggcacgaataacacctctgtattgattaaggggaatgcattaacaacatca
aatagtaatagtaccgctactagtagtaacaatactgcatcggatgagacatcttcttca
aattctccgtcaatgaaacagccaactataagttctctagcaaaagttaatacaaatagt
aggcacagattattaaccacacctccatcaaaattgaattcaacttccaactataagact
cctagaaatataaataattccaacaattcaaataacaatttaagttcatcaatgaggaaa
aaactaaacttaaccagctctaatgaagaaactaatactaccagtaacaataataataag
gactcattaaatgacattttatacatattcgcattaattttgaaatcggcatcccaattt
gattcatataaggcaatacgattgttcgattccaaattaccaaaacaaattaaaaataat
atgccctggtgtcaagctcaattaggtaaattacattttgaaattgttaattataagacc
tcattaaaatactttaaaaagttaaggttattgcaaccaacgagaattaaagatttagaa
actttttccactttattatggcatttgcatgataagacaaatttaactgacttatcaaat
attctgatggatgaattcagagacaaaccggagacttggtgtgcagtaggtaatttattc
tctttacaaaaggaccacgatgaggctataagggcgttcgataaggcaacaaaattagat
ccaaattttgtttatgcttacactttacaaggtcatgaatatctgtccatggactcctat
gacacggcaaagactttttatagaaaggcaatctcaaatgacttacatcattataacgca
tattatggtatgggaatgtgttctatgaaattaggtgaatacgaacaagcattagtttac
tttgaaaaggcaagatcaattaatccaagtaatgcaatcttaatctgttgttgtggtgtc
actatggaaaaattaggaaaccaagaaaaggcattaaattattacgaactggcatgccaa
atacaacctacatcgtcgttggctaaattcaagagagctcatttattatattctatggca
aaatacactcaggctttggatgcatttgaagaattgattaaaatagctcctgaagaagct
accgtacaattcatactgggccaattatatcaaattatgggtaggaaaaaggatgcaatc
aagagatacaccattgccatgaatctggatccaaagggctcaaatttgatctctgatgca
ttaaagaaatgtcacgaacaagaggaataa

DBGET integrated database retrieval system