KEGG   Naumovozyma castellii: NCAS_0E02490Help
Entry
NCAS_0E02490      CDS       T02233                                 

Gene name
NCAS0E02490
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ncs  Naumovozyma castellii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NCAS_0E02490 (NCAS0E02490)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0E02490 (NCAS0E02490)
   04113 Meiosis - yeast
    NCAS_0E02490 (NCAS0E02490)
Protein phosphatases and associated proteins [BR:ncs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NCAS_0E02490 (NCAS0E02490)
Ubiquitin system [BR:ncs04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NCAS_0E02490 (NCAS0E02490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(493779..496208)
Genome map
AA seq 809 aa AA seqDB search
MLFPPRSSTFDGKDSPKQQFQKTGPLEDDDLDSCIHLSQSSLGKLQDAIQTAIEQLNYDT
AEFLSELLHAHCCKPFEDANTITQRIAAAYLYSLSLFLNQKYTTAMEIAREESRKNIDVA
FIFGKCSLQVNTDTKLAIQSLIDLKSNINLNSNSNGTTATNATMNTCTTNLIHSPDMATI
DSLIAKLYYKLDRQHESALFHSEALNQNPYLWESYTELCSMKVKIDLRKLYKQTSSWSSS
SSSSSSSKIKKNTGYRKLRDSSAKAITDPSIIQYHKNKNSPYSKRFNSTPRKPTPFNLSV
PWYSSLSNESANPSPFGDQVSTTINNNNTSTNIGSNILQPNTIIGWPTNSNTHPNLRNNS
PITGTNNTSVLIKGNALTTSNSNSTATSSNNTASDETSSSNSPSMKQPTISSLAKVNTNS
RHRLLTTPPSKLNSTSNYKTPRNINNSNNSNNNLSSSMRKKLNLTSSNEETNTTSNNNNK
DSLNDILYIFALILKSASQFDSYKAIRLFDSKLPKQIKNNMPWCQAQLGKLHFEIVNYKT
SLKYFKKLRLLQPTRIKDLETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLF
SLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNA
YYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQ
IQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAI
KRYTIAMNLDPKGSNLISDALKKCHEQEE
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttccaccgcgcagctccacatttgatggaaaggacagccccaaacagcaattt
caaaagacaggacccttggaagatgatgatctggactcatgcatccatttatcgcagagt
tccctgggtaaattacaagatgcgatccaaactgccatagaacaattgaattatgatact
gccgagtttttatccgagttgctacatgcgcattgctgcaaaccattcgaggatgctaac
actatcacgcaaaggatagctgccgcttacttatattcactgtcattattcttgaatcaa
aaatatacaactgccatggaaattgctagggaagagagtcggaagaatatagatgttgcg
tttatttttggtaaatgttcattacaagtgaatacagatacaaagctggccattcagtca
ttgattgatttaaaatcaaacattaacttgaattctaatagtaatggtacgaccgcaacg
aacgccaccatgaatacttgcactacaaatctcatccattcaccagacatggcaaccata
gactctcttatagcgaaattatattataaactggatagacaacatgagagcgctttattt
cattcagaagctttaaatcaaaatccttatctttgggagtcctatacggaactgtgtagt
atgaaagtgaaaattgatttgaggaaactatataaacaaacttcttcctggtcgtcgtcg
tcatcatcatcatcatcttcaaagataaagaagaataccggttatcggaaactaagagat
tcatcggcaaaagcgataacagatccatctattatacaatatcataagaacaaaaattct
ccatattctaaacgattcaattctaccccaagaaagccaactccatttaatttgtctgtg
ccatggtattcctcattatctaacgaatcagcaaacccttccccatttggagaccaggta
tctacaacaattaataacaataatacttctactaatattggaagtaatattttacaacca
aacactataattggatggcctacaaattctaatactcatcccaatttgagaaataatagc
cccatcactggcacgaataacacctctgtattgattaaggggaatgcattaacaacatca
aatagtaatagtaccgctactagtagtaacaatactgcatcggatgagacatcttcttca
aattctccgtcaatgaaacagccaactataagttctctagcaaaagttaatacaaatagt
aggcacagattattaaccacacctccatcaaaattgaattcaacttccaactataagact
cctagaaatataaataattccaacaattcaaataacaatttaagttcatcaatgaggaaa
aaactaaacttaaccagctctaatgaagaaactaatactaccagtaacaataataataag
gactcattaaatgacattttatacatattcgcattaattttgaaatcggcatcccaattt
gattcatataaggcaatacgattgttcgattccaaattaccaaaacaaattaaaaataat
atgccctggtgtcaagctcaattaggtaaattacattttgaaattgttaattataagacc
tcattaaaatactttaaaaagttaaggttattgcaaccaacgagaattaaagatttagaa
actttttccactttattatggcatttgcatgataagacaaatttaactgacttatcaaat
attctgatggatgaattcagagacaaaccggagacttggtgtgcagtaggtaatttattc
tctttacaaaaggaccacgatgaggctataagggcgttcgataaggcaacaaaattagat
ccaaattttgtttatgcttacactttacaaggtcatgaatatctgtccatggactcctat
gacacggcaaagactttttatagaaaggcaatctcaaatgacttacatcattataacgca
tattatggtatgggaatgtgttctatgaaattaggtgaatacgaacaagcattagtttac
tttgaaaaggcaagatcaattaatccaagtaatgcaatcttaatctgttgttgtggtgtc
actatggaaaaattaggaaaccaagaaaaggcattaaattattacgaactggcatgccaa
atacaacctacatcgtcgttggctaaattcaagagagctcatttattatattctatggca
aaatacactcaggctttggatgcatttgaagaattgattaaaatagctcctgaagaagct
accgtacaattcatactgggccaattatatcaaattatgggtaggaaaaaggatgcaatc
aagagatacaccattgccatgaatctggatccaaagggctcaaatttgatctctgatgca
ttaaagaaatgtcacgaacaagaggaataa

DBGET integrated database retrieval system