KEGG   Naumovozyma castellii: NCAS_0E02610Help
Entry
NCAS_0E02610      CDS       T02233                                 

Gene name
NCAS0E02610
Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NCAS_0E02610 (NCAS0E02610)
Peptidases [BR:ncs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NCAS_0E02610 (NCAS0E02610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(520877..523030)
Genome map
AA seq 717 aa AA seqDB search
MLKRWLTVKKKKTVINDKATVDVDVAITVTNIDEESIGPLETLDRLDDDWEYTLNPKGTE
FPTDASSTFQVKEVLGTNTDAEYSAISKNPFITNEVGEDEVLNFPILFANTINEQLPFGD
GSNKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQYPERNLMDQRVRKLEMPGYKPRCF
SEASFEKPQTTTGASVPAQDANNNQNNTTTANGNNNSNNFKTPSAQNKNIFKGLFGYGNS
KINTEPLSQMADSSTSTDLELPDENIVGKEEDQHEGEEEEGNNNHDGQPIDQEIKLLPNS
HKIIIGRTPPVLNPNTRNNSQVSGASNNDLLPVHISTEQRKKTALIEGPILTIDHLINSF
EPSQGDLYNTLKDLFECITEHSSLTGIVSPVQFVNMLRRENVLFDSMMHQDAHEFLNFML
NDFSDRLDRDNQAKNFINEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTDIQ
RVLKYYSQREMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIK
LFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDGPQMGHYVALCKTEKYGWLFYDDE
TVESVSEETVLKFIGDEKTQSTAYVLFYKKLGDKETNIDHNPEQFADNFKQLIKYDDRWR
LRKKSMAQFNADNSNTNNTNHNLSVHAADDSYNEVDQTFTSTNTEKSKVSRLFSFMK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagatggttaactgtgaagaaaaagaagactgtaataaatgacaaagccact
gtcgacgtcgacgtcgccatcacggtcactaacattgatgaagaatcaataggcccactc
gaaacactagatagactagatgatgattgggagtacacactgaatccaaagggcaccgag
tttcccacagatgcctctagtaccttccaagtgaaagaggtgctaggcacaaatactgat
gcggagtatagtgcaattagcaaaaatccatttattacaaatgaagtgggagaggatgaa
gtattgaactttcccatcttatttgcaaataccataaatgagcagctaccatttggagat
gggtccaataaggttttcgggtatgagaattttgggaatacatgctattgtaattccgtg
ttacaatgtctatataatttgcctgaatttagattgaacatattacaatatcctgagcga
aatttaatggatcagagagtacgaaagctggaaatgcccgggtataaacctaggtgtttc
tcagaggctagtttcgagaaaccacaaacaacaactggagcctcggttccagcacaagat
gctaacaataatcaaaataatacaactaccgctaatggtaataataatagcaataatttc
aagacaccttctgctcaaaacaaaaatattttcaagggcttattcggatatggtaattcc
aaaataaatactgaaccactttcgcagatggctgattcaagcacaagcacagaccttgaa
cttccagatgaaaacattgttgggaaagaagaagatcaacatgaaggagaagaagaagag
ggaaacaataaccatgatgggcaacctattgatcaggaaataaaattactacccaactcg
cacaagataatcattggcaggacaccacctgtcttgaatccaaatacacgtaacaattca
caagtatcaggagccagtaataatgatttgctaccggtacatatatctacagaacaaagg
aagaaaacggcattaatagagggtccaatcttaactattgatcatttaatcaatagtttt
gagccatctcaaggtgacttgtacaatactttgaaggatttattcgaatgtataactgaa
cattcttcattgacgggaattgtatcgccggtccaatttgttaacatgctaagaagggag
aatgttctatttgattcgatgatgcatcaggacgctcatgaattcctaaactttatgttg
aatgactttagtgatcgtttagacagagataatcaagccaagaattttataaatgaaata
tttcaaggtacattgactaataaagttcgttgtctgacatgtgataatgtcacctctaga
gaagaagcatttctggatctaccaattgaggttaaagaaaatggtgatactgatattcaa
agagttttgaagtattattctcaacgagagatgctaaatggttcgaacaaatttaattgt
agtcaatgttgtgcattacaagaagcggaaagagccgttgaattaaagaaattacccgat
acattaatattgcatttgaaaaggttcaagtactcagaacaacaactctctaatatcaaa
ctttttagtaaagtatactatcccttaattcttgaggtaaactccaattataaatgcacg
gataccatcaaatatgagttgagtggtattgttatacatgttggtgatggaccacagatg
ggacattatgttgcactttgtaagacagagaaatatgggtggttattctacgatgatgag
acggtagaatctgtgtcggaggagactgttctaaaattcattggtgacgaaaagactcaa
agcacagcatatgtccttttttacaagaaacttggtgacaaggaaacaaacatagatcat
aacccagagcaattcgctgacaatttcaagcaattgattaaatatgacgacaggtggaga
ctccgcaagaaaagtatggcacagtttaatgccgataatagtaacactaataatactaat
cataacctcagcgttcatgctgcggatgattcgtataatgaagtggatcaaacgtttacg
tcaacaaacacagaaaaatcaaaagtatcaaggctgttcagttttatgaaataa

DBGET integrated database retrieval system