KEGG   Naumovozyma castellii: NCAS_0E02610Help
Entry
NCAS_0E02610      CDS       T02233                                 

Gene name
NCAS0E02610
Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(520877..523030)
Genome map
AA seq 717 aa AA seqDB search
MLKRWLTVKKKKTVINDKATVDVDVAITVTNIDEESIGPLETLDRLDDDWEYTLNPKGTE
FPTDASSTFQVKEVLGTNTDAEYSAISKNPFITNEVGEDEVLNFPILFANTINEQLPFGD
GSNKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQYPERNLMDQRVRKLEMPGYKPRCF
SEASFEKPQTTTGASVPAQDANNNQNNTTTANGNNNSNNFKTPSAQNKNIFKGLFGYGNS
KINTEPLSQMADSSTSTDLELPDENIVGKEEDQHEGEEEEGNNNHDGQPIDQEIKLLPNS
HKIIIGRTPPVLNPNTRNNSQVSGASNNDLLPVHISTEQRKKTALIEGPILTIDHLINSF
EPSQGDLYNTLKDLFECITEHSSLTGIVSPVQFVNMLRRENVLFDSMMHQDAHEFLNFML
NDFSDRLDRDNQAKNFINEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTDIQ
RVLKYYSQREMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIK
LFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDGPQMGHYVALCKTEKYGWLFYDDE
TVESVSEETVLKFIGDEKTQSTAYVLFYKKLGDKETNIDHNPEQFADNFKQLIKYDDRWR
LRKKSMAQFNADNSNTNNTNHNLSVHAADDSYNEVDQTFTSTNTEKSKVSRLFSFMK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagatggttaactgtgaagaaaaagaagactgtaataaatgacaaagccact
gtcgacgtcgacgtcgccatcacggtcactaacattgatgaagaatcaataggcccactc
gaaacactagatagactagatgatgattgggagtacacactgaatccaaagggcaccgag
tttcccacagatgcctctagtaccttccaagtgaaagaggtgctaggcacaaatactgat
gcggagtatagtgcaattagcaaaaatccatttattacaaatgaagtgggagaggatgaa
gtattgaactttcccatcttatttgcaaataccataaatgagcagctaccatttggagat
gggtccaataaggttttcgggtatgagaattttgggaatacatgctattgtaattccgtg
ttacaatgtctatataatttgcctgaatttagattgaacatattacaatatcctgagcga
aatttaatggatcagagagtacgaaagctggaaatgcccgggtataaacctaggtgtttc
tcagaggctagtttcgagaaaccacaaacaacaactggagcctcggttccagcacaagat
gctaacaataatcaaaataatacaactaccgctaatggtaataataatagcaataatttc
aagacaccttctgctcaaaacaaaaatattttcaagggcttattcggatatggtaattcc
aaaataaatactgaaccactttcgcagatggctgattcaagcacaagcacagaccttgaa
cttccagatgaaaacattgttgggaaagaagaagatcaacatgaaggagaagaagaagag
ggaaacaataaccatgatgggcaacctattgatcaggaaataaaattactacccaactcg
cacaagataatcattggcaggacaccacctgtcttgaatccaaatacacgtaacaattca
caagtatcaggagccagtaataatgatttgctaccggtacatatatctacagaacaaagg
aagaaaacggcattaatagagggtccaatcttaactattgatcatttaatcaatagtttt
gagccatctcaaggtgacttgtacaatactttgaaggatttattcgaatgtataactgaa
cattcttcattgacgggaattgtatcgccggtccaatttgttaacatgctaagaagggag
aatgttctatttgattcgatgatgcatcaggacgctcatgaattcctaaactttatgttg
aatgactttagtgatcgtttagacagagataatcaagccaagaattttataaatgaaata
tttcaaggtacattgactaataaagttcgttgtctgacatgtgataatgtcacctctaga
gaagaagcatttctggatctaccaattgaggttaaagaaaatggtgatactgatattcaa
agagttttgaagtattattctcaacgagagatgctaaatggttcgaacaaatttaattgt
agtcaatgttgtgcattacaagaagcggaaagagccgttgaattaaagaaattacccgat
acattaatattgcatttgaaaaggttcaagtactcagaacaacaactctctaatatcaaa
ctttttagtaaagtatactatcccttaattcttgaggtaaactccaattataaatgcacg
gataccatcaaatatgagttgagtggtattgttatacatgttggtgatggaccacagatg
ggacattatgttgcactttgtaagacagagaaatatgggtggttattctacgatgatgag
acggtagaatctgtgtcggaggagactgttctaaaattcattggtgacgaaaagactcaa
agcacagcatatgtccttttttacaagaaacttggtgacaaggaaacaaacatagatcat
aacccagagcaattcgctgacaatttcaagcaattgattaaatatgacgacaggtggaga
ctccgcaagaaaagtatggcacagtttaatgccgataatagtaacactaataatactaat
cataacctcagcgttcatgctgcggatgattcgtataatgaagtggatcaaacgtttacg
tcaacaaacacagaaaaatcaaaagtatcaaggctgttcagttttatgaaataa

DBGET integrated database retrieval system