KEGG   Naumovozyma castellii: NCAS_0E02750Help
Entry
NCAS_0E02750      CDS       T02233                                 

Gene name
NCAS0E02750
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCAS_0E02750 (NCAS0E02750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(545626..547782)
Genome map
AA seq 718 aa AA seqDB search
MPLDDTTRTQDSIAKRHRVSSSSLLRNLIIDDNIHSPFVNINEQLASSANANGTDPLHSR
RRNTNRKVNYVFKSRRPTAVRNSRENIDSSPRLLLPDSIDEANQLNPYIKFSNGLDDTTP
ITPYGKLTIKYNPLKLYNFKKILHNSSSDESRLHHDNDTSFPVNPQKDRNSNDHLADSIL
PYNGAIPKQKDFSTLNTTPTTIDRQFFHDLLIQSSNASHFNANVTLSSYNQNLIKGTKKR
LTQPPHGSSSIEYIFINNHEIKTWYNSPFPSPINKNKILHICDRCLKYYNSRYQYHRHDL
KCPIYLPPPGNEIYRDGAISFWEIDGRENVTYCQNLCLLSKLFLNSKTLYYDVDPFIFYV
LTERGKDNKYHLIGYFSKEKLNSLNYNLSCILTLPIYQRRGFGHLLMEFSYLLSMREFKS
GTPEKPLSDLGLLAYRNFWKIKMATTLVSFKDNLQGKTLKLSLNDLSNLTGMITTDVVFG
LEQLQVLYKSTTTSSYIIKIDSWSRIEEIVTNWSNKNYQTLNPSKLIWKPMIFGPSFGVN
TISIDPISSTTSTNMITKSGTDFFNKHIDTLTNFMTDDILDPTDLEIVTREAILQNLKNS
DDVDTENINADDYEICFVEPTLNEKSSSGSSKRPTTTNSTNKVTETQRTTAEEQEEEEEE
VNDDLDLLEPIEEPDPEDDEEYSEEGEDSTNAIDESSDDDIDNEDLLNSKLELEDDDD
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgatgataccacacgtacacaggactcaattgccaagcggcaccgggtctca
tcttcatcgttgttgagaaacctaataattgatgataacatccactcgccctttgtaaac
attaatgaacaactagcatcatctgccaatgctaacggtactgatccgctacattctagg
aggagaaacacgaataggaaggtcaattatgtctttaagagtcgtcgtcctactgccgtc
cgcaatagtagagagaatatcgattcatcgccgcgtcttttattacctgattccatcgat
gaggcaaaccaattgaatccatacattaaattctcaaatggtcttgatgatacaacaccg
atcacaccgtatgggaaattgactattaaatataacccactaaagttgtacaattttaaa
aaaatactacataattcgtcatcggatgaaagtagacttcatcacgataacgatacaagt
ttccccgtcaacccccaaaaggatagaaacagtaacgatcatcttgctgattctatatta
ccatataatggcgcaattccaaaacaaaaggatttttccactttaaacacaactccgacg
acaatagacagacaattctttcatgacttactcatacaatcatcaaatgcatcacatttc
aatgccaacgtcactttatcttcatacaaccaaaatcttatcaagggaacgaaaaagaga
ctgacacagccaccgcatggatcttcatccattgaatatattttcattaacaatcatgag
attaagacatggtataattcacccttcccatcaccgatcaataaaaataaaatccttcac
atttgcgaccgatgtctaaaatattataactctcgttaccagtatcatagacacgatctt
aagtgccccatatatctaccaccaccggggaatgaaatttatagagacggtgccatatca
ttctgggaaattgacggaagggaaaacgtcacatattgtcaaaatttatgtctattatcc
aagttattcttaaattcaaagaccttatattatgatgtggatccattcatcttttatgtg
cttacagagagaggtaaggataataaatatcatttgattggatatttttcgaaggaaaaa
ctaaattctttgaactacaatttaagttgtatcttaactttacccatttatcaacgtcgt
ggatttggccatttattaatggaattttcctatttattatcaatgagagaatttaaatca
ggtacacctgagaaaccgttgtccgatttaggtctccttgcatatagaaatttttggaaa
attaagatggcaacgacattagtatcatttaaagataaccttcagggaaagaccttgaaa
ttatcattgaatgatttgtcaaatttaacaggaatgataacaacggatgttgtctttggg
ttggaacaattgcaggtgctatataagtccactactacatcttcatatataataaagatc
gattcatggtccagaatcgaagaaattgtcaccaattggagtaataagaattatcaaact
ttaaatcctagcaagttaatttggaaaccaatgatttttggaccctcatttggtgtcaat
accattagcattgatcctatatcatccacaacgagtactaatatgattaccaaatcgggc
actgatttctttaataagcatatcgatactttgaccaatttcatgaccgacgacattttg
gacccaacagatttagaaatagtcactagggaagctatcctgcagaatttaaaaaatagt
gacgatgttgatacggagaacataaatgcagatgattatgaaatttgctttgtggaacca
actttgaatgaaaaatcttcatcaggatcatcgaagagaccaacgacaacaaattctaca
aacaaagtaaccgagacgcaacgaactacagcggaagaacaagaagaagaggaagaggag
gtcaatgatgacttagacttactagaacccattgaagaacctgacccggaagatgacgaa
gaatacagtgaagagggtgaagattcaactaatgcaatagatgaaagttcagatgatgat
attgataatgaagatctactaaattccaaactcgaacttgaagatgacgatgactag

DBGET integrated database retrieval system