KEGG   Naumovozyma castellii: NCAS_0E03310Help
Entry
NCAS_0E03310      CDS       T02233                                 

Gene name
NCAS0E03310
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ncs01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ncs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:657279..658934
Genome map
AA seq 551 aa AA seqDB search
MSIEFNALQHQLDATTTEIEKWWSQPRWNSTKRTYTAREIAARRGNFPALTYPSSVMADK
LFKVLENHHENKTVSKTFGALDPVQITQMCRYLDTIYVSGWQCSSTASTSNEPGPDLADY
PMDTVPNKVEHLFKAQLFHDKKQLECRSRCTSPSELKEQGAPIDYLRPIIADADAGHGGL
TAVFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRCVIPVQEHISRLITIRMSADIMNS
NLIIVARTDSEAATLLSSTIDKRDHYFIVGATNPNQRESFVEVIDEAIGKGYNATQLAAV
EQKWIEEAGLKLFHEAFADEVKKSELPAATKQEIINKFNAKVGPLTETSNKEARAIAKQL
LGHDIYFNWETPRVREGLYRYRGGTQCAVMRARAFADYADLVWMESNYPDYEQAKEFAEG
VKAKYPNQWLAYNLSPSFNWTNVMSPQDQKTFIQRLGDLGYIWQFITLAGLHTTALASHQ
FTRDFAKDGMMAYAQNVQQREMDEGVDVLKHQKWSGAEYIDGVLKLAQGGISATAAMGKG
VTEDQFKESKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgaattcaacgctctacaacatcaattagatgctaccaccactgaaattgaa
aaatggtggtctcaaccacgttggaactccaccaagagaacttacactgccagagaaatt
gctgcaagacgtggtaatttccccgctttaacttacccatcatctgtcatggctgataaa
ttattcaaagtcttggaaaatcatcatgagaataagactgtctcaaagactttcggtgcc
ttagatcccgtacaaattactcaaatgtgcagatatttggataccatttatgtctcagga
tggcagtgttcctctactgcatccacttccaatgaacctggtccagatttagctgattat
cctatggatactgtgccaaacaaagtggaacatttattcaaagctcaattatttcacgat
aagaaacaattagaatgtagaagtagatgcacttcaccatctgaattaaaggaacaaggt
gctccaattgattatttgagaccaattattgctgatgctgatgctggtcatggtgggtta
actgctgttttcaaattgactaagatgtttattgaacgtggtgctgcaggtatccatatt
gaagatcaaacttcaactaataagaaatgtggtcatatggccggtagatgtgttatccca
gtgcaagaacatatctctagattaattaccattagaatgtctgctgatattatgaattct
aatttgatcattgtcgcaagaactgattctgaagctgcaacacttttaagttccactatt
gataagagagatcattattttattgtaggtgcaaccaatccaaatcaacgtgaatcattc
gtggaagtcattgatgaagccattggtaagggttacaatgccactcaattagccgctgtt
gaacaaaaatggattgaagaagctggattgaaattattccatgaagcctttgctgatgaa
gtgaaaaaatctgaattaccagctgccaccaagcaagaaattattaataaatttaatgct
aaagtgggtcctttgactgaaacatctaataaggaggcaagagccattgctaaacaatta
ttgggacatgatatttacttcaattgggaaactccacgtgtaagagaaggtttataccgt
tacagaggtggtactcaatgtgctgtgatgagggcacgtgcctttgctgattatgctgat
ttagtatggatggaatctaattatcctgattatgaacaagctaaagaatttgctgaaggt
gtcaaggctaaatatccaaatcaatggttagcatacaatttatcaccatcatttaattgg
acaaacgtaatgtctccacaagatcaaaagacatttattcaaagattgggtgatttgggt
tacatttggcaattcattacgttggccggtctacatactactgcattggcatctcatcaa
tttactcgtgatttcgctaaagacggtatgatggcatatgcacaaaatgttcaacagaga
gaaatggatgaaggtgtggatgtcttgaaacatcaaaaatggtctggtgctgaatacatt
gatggtgttctaaaattggctcaaggtggtattagtgcaactgccgccatgggtaaaggt
gtcactgaagatcaattcaaagagagcaagttataa

DBGET integrated database retrieval system