KEGG   Naumovozyma castellii: NCAS_0E03900Help
Entry
NCAS_0E03900      CDS       T02233                                 

Gene name
NCAS0E03900
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NCAS_0E03900 (NCAS0E03900)
Transcription machinery [BR:ncs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NCAS_0E03900 (NCAS0E03900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(766835..768202)
Genome map
AA seq 455 aa AA seqDB search
MVTKDSNSPVKRADEQGEGGPLTKKPKLENDDENSKIDETTAKQNLETLNSSPIADGFDE
MENNETRQEDSKLPNPVVNDSVVADEEKGIVKFEFDGVEYKFKERPSVIEEKEGNIEFRV
VNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHISMAVVRKPLTVVGGITYR
PFDKRQFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQ
GFTKEISLDKSIWMGYIKDYEGGTLMQCSMLPKIRYLDAAKILLLQEAALRRKIRTISKS
HVVRPGLEHFKDLTNITPIDPMEIPGLKEAGWTPEMDELAQRPKRGPHYVIIQNILTGLQ
NHAAAWPFLQPVNKEEVPDYYEFIKEPMDLSTMEMKLENNKYQKMEDFIYDARLVFNNCR
KYNGENTSYFKYANRLEKYFNGKIKEIPEYSHLVN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccaaggatagcaattcgccagtgaaaagagctgatgaacagggagaaggaggc
cccttgacaaagaagccaaaactggaaaatgatgatgagaattcgaaaatagatgagacc
actgcgaaacaaaacctagaaactttgaactcatctcccatagctgatgggtttgacgaa
atggaaaataatgagacacgccaggaagattcaaaattaccaaaccctgtagttaatgat
tctgtcgtagcggatgaagaaaagggaattgttaaatttgaatttgatggtgttgagtat
aaatttaaggaaaggccgagcgtcattgaggagaaggagggaaatatagagttcagagta
gtcaacaatgataataccaaggaaaatatgatggttttgacaggtttgaagaacatcttt
caaaagcaattaccaaagatgccaaaggaatatattgccagattagtgtatgacagaagt
catatttcaatggcagtcgttaggaagccattgactgtcgttggtggtattacataccgt
ccctttgataaacgtcaatttgcagaaattgttttctgtgctataagttccacagaacaa
gttcgaggatacggtgcacatttaatgaatcatttgaaagattatgtgaggaacacttcc
aatatcaaatactttctaacatatgctgataattatgccattggttatttcaagaagcaa
gggttcacaaaggaaatttcgttggataagagtatatggatgggttacattaaagactat
gaaggtggtactcttatgcaatgttccatgttgcctaagatccgttatttagatgctgct
aaaattttgttattgcaggaagctgcattaagaagaaagattagaactatatcgaagtca
cacgttgtaaggcctggactagaacattttaaagatttaacaaatataacaccaattgat
ccaatggaaattcccgggttaaaagaagcaggctggaccccagaaatggatgaattagct
caacgacctaaacgtggtccacattatgtgattattcaaaatatattaactggattacaa
aatcacgctgctgcatggccctttttacaaccagttaataaagaagaagttcctgattat
tatgaatttattaaggaaccaatggatttgagcacaatggagatgaaactggaaaataat
aagtatcaaaagatggaggatttcatttatgatgcgagactggttttcaataattgtcga
aaatataatggtgaaaacacgtcgtattttaagtatgcaaacagattagaaaaatacttc
aatggcaagataaaggaaataccagaatactcgcatttagtaaactag

DBGET integrated database retrieval system