KEGG   Naumovozyma castellii: NCAS_0F00230Help
Entry
NCAS_0F00230      CDS       T02233                                 

Gene name
NCAS0F00230
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ncs  Naumovozyma castellii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NCAS_0F00230 (NCAS0F00230)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NCAS_0F00230 (NCAS0F00230)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:35422..37239
Genome map
AA seq 605 aa AA seqDB search
MENSSNTSSAQNLLLTLNASYSKAILTDEGILIQSEHNICHSITEQSDSKEDTAGRSESS
TSLISCIACLDDLENETSIENLIPMNTLIPYGRILNARYLNESKVPPNKFCADIRQPSSS
SNISSRSSTKLMEEGQETNKELRTPFLSENENGEQIESFQLKNFDRNEYSIELSFVIPSG
DDIVAKKINLSISYIPSMTTNKSVVEEIMLRSYKNVNRNRSILVIINPHGGKGKAKLLFE
KKAKPILIASNCSLEIIHTKYSRHALDIAKDLDITKYDVIACASGDGIPYEVINGLYQRP
DRADAFNKLTITQVPCGSGNAMSISCHWTDNPSHAALCLLKSVERRIDLMCCSQVSYMDD
CPRLSFLSQTFGVIAESDINTEFIRWMGPIRFNLGVAYNVFQGKKYPCDIFVRYASKSKQ
ELKDHYLKHKRRAELESERSNERVPNSRCKDPLEYTVTEGDFELKYPLRDGIPDDWERLN
PEITENLNIFYTGKMPYISADTNFFPAALPSDGTFDLIITDVRTPITKITPILLSLDKGS
HVLHPEVIHSKITAYKMIPKISDSIISVDGERFPVEPLQVEIMPKLCKTLLRNGCYVDSK
FDKIC
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcaagcaacactagcagtgcacaaaacttattgcttactttaaatgcaagt
tatagcaaagccattcttacagatgaaggtattttaattcaatcggagcataatatatgc
cattccatcacggagcaaagcgactctaaggaagataccgccggaaggagtgaatcttct
acctcgttaatcagttgcatcgcctgtctcgatgatctagaaaatgaaacttccattgag
aatttaattccgatgaatactttgataccatatggtagaattcttaacgcaagatacctt
aatgaatcgaaagtacctcctaacaagttctgtgctgatataagacaaccgtcatcctca
tcaaatatttcatcaagaagttctacaaagttaatggaagaaggacaagaaacgaataag
gaactaaggacaccatttctttctgagaatgaaaatggggaacaaattgaaagtttccaa
ttgaaaaatttcgataggaacgagtactctattgagctatcatttgttataccctctggg
gacgacatagtagcaaagaagataaacctttccattagttatataccatctatgacaaca
aataagagtgtggtggaggagatcatgcttagaagttataagaatgttaatcgtaacaga
tcaatactggtcattattaacccacatggcggtaagggaaaggcaaaactattattcgaa
aagaaggcaaaaccaatcttaatagcatctaactgttcactagagattatccatactaaa
tattctcgccatgcattagatattgcaaaagatttagatataaccaaatatgacgttatt
gcttgtgcctctggtgatgggatcccatatgaagtgatcaatgggttataccagagacct
gatagagctgatgcttttaacaagctgactataacacaagtaccatgcggatcagggaat
gcaatgagtatatcttgccattggacagataatccatctcatgcagcattatgtctacta
aaatccgtcgaaagaagaatcgatttgatgtgctgttctcaagtatcgtatatggatgat
tgtccaagactgtctttcttgagtcaaacatttggtgtgatagcggaatcagatatcaat
acagaatttatcagatggatgggtccaataagattcaacctcggtgttgcctataatgta
ttccagggaaagaaatacccttgtgatatatttgttcgatatgctagcaaatctaagcaa
gagttaaaggatcattatttgaaacataagaggagagctgaattagaatctgaacgttct
aatgaaagagtgccaaattcacgttgcaaagatcccctagaatatactgtaacggagggg
gattttgaactaaaatatccgctgagagatggtattccagatgattgggaaaggctcaat
cctgagattacagaaaatttgaacatattctatactggtaagatgccttatatctctgca
gacacaaacttctttccagctgcattgcctagtgatggtacgttcgacctaataataaca
gacgtaaggacacctattactaagattacaccaatattactttcattagataaagggtct
catgttttacatcctgaagttatccattcaaaaattacagcatataaaatgataccgaag
atttctgacagtataatctctgtagatggtgaaagatttccagtagagccactccaagtt
gaaattatgccaaagttatgtaaaacgttgttaaggaatgggtgttatgttgattcaaaa
tttgacaaaatttgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system