KEGG   Naumovozyma castellii: NCAS_0F00490Help
Entry
NCAS_0F00490      CDS       T02233                                 

Gene name
NCAS0F00490
Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCAS_0F00490 (NCAS0F00490)
   01230 Biosynthesis of amino acids
    NCAS_0F00490 (NCAS0F00490)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0F00490 (NCAS0F00490)
   00030 Pentose phosphate pathway
    NCAS_0F00490 (NCAS0F00490)
   00051 Fructose and mannose metabolism
    NCAS_0F00490 (NCAS0F00490)
   00052 Galactose metabolism
    NCAS_0F00490 (NCAS0F00490)
  Energy metabolism
   00680 Methane metabolism
    NCAS_0F00490 (NCAS0F00490)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NCAS_0F00490 (NCAS0F00490)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NCAS_0F00490 (NCAS0F00490)
Protein phosphatases and associated proteins [BR:ncs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NCAS_0F00490 (NCAS0F00490)
Messenger RNA biogenesis [BR:ncs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NCAS_0F00490 (NCAS0F00490)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:89926..92889
Genome map
AA seq 987 aa AA seqDB search
MVSQETCYGVAFRSLATTDEQLFQNTVQFYHNLGFSTIKDFNKFHNGDNSILSTGTSKDS
IKETWLEAFKLSEIDAQGFRVPQQEALNKNQSQGALLKVRLIMSQQQLPTEPLSITYFTT
DLTSVSNLPSAEKISDSIVVLTDPLGTKIGFTSFSTPFDSQAQAHDAAFFQSAANVSESS
SDVSRDASLSAINMLKQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAV
YEGYEGLLRGGEYLKKMAWEDVRGWLSEGGTLIGTARSMEFKKREGRKQAAGNLIEQGID
ALVVCGGDGSLTGADLFRHEWPSLVEDLVKDGRFTEEQVTPYRNLKIVGLVGSIDNDMSG
TDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFIP
ERAVPHGQWQDELKEVCQRHRAKGRRNNTIIVAEGAIDDQLNPVTCEDVKNVLIELGLDT
KVTILGHVQRGGTAVAHDRWLATLQGVDAVKAILEMTPETPSPLIGILENKIIRMPLVES
VKLTQSVAAAIESKNFDKAISLRDTEFIELYENFLSTTVKDDGSEMLPVTERLNIGIVHV
GAPSAALNAATRAATLYCLSHGHTPIAIMNGFSGLIQTGEVKKMEWIDVENWHNLGGSEI
GTNRSVAAEDLGTIAYYFQKIKLDGLIILGGFEGFKSLKQLRDGRSQHPIFNIPMTLIPS
TISNNVPGTEYSLGVDTCLNALVKYTDDIKQSASATRRRVFVVEVQGGHSGYIASFTGLI
TGAVSIYTPEDKINLSSIQEDLTLLEENFRHDQGENRNGKILIRNEQASSVYSTELIANL
ISESCHGRFGVRTAIPGHAQQGGVPSSKDRVVASRFAVKCIKFIEQWNKNNQAPGTNTDS
KILRFKFDAQGEKVPTIEHEDDSAAVICVNGSSISFKPIAGLWENETNVELRKGQEVHWT
EYNKISDILSGRMKLRDEVAALAAESN
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggtatctcaagaaacctgttacggtgtagcatttagatctctggctaccaccgacgaa
caactgttccaaaataccgtccaattctaccataatctaggtttcagcaccatcaaggac
ttcaacaagttccacaatggcgacaacagtatcctttccacagggacttccaaggactcc
ataaaggaaacatggttggaagcattcaaattgagtgaaattgacgctcaaggtttccgt
gtgcctcaacaagaagctttaaacaagaaccaaagtcaaggtgctcttttgaaggtgcgt
ttaatcatgtctcaacaacaattaccaacggaaccactatcaatcacttatttcaccact
gatttgacctctgttagtaacttaccatccgctgaaaagatctccgactccattgtcgtc
ttaactgatccattgggaaccaagatcggtttcacctctttctctactccatttgactct
caagctcaagctcatgatgctgctttcttccaaagcgcagctaacgtttctgagtcttca
tcagacgtttctagagacgcctctttatccgccatcaacatgttgaagcaaaccctttcg
ggccaaaagaagaagaagattgccgtcatgacttccggtggtgattctccaggtatgaac
gctgccgtgagagctgttgttcgtacaggtatccattttggttgtgatgttttcgcagtc
tacgaaggttacgaaggtttactaagaggtggtgaatatttgaaaaaaatggcttgggaa
gacgttagaggttggttatctgaaggtggtactttgattggtactgcccgttccatggaa
tttaagaaacgtgaaggtcgtaaacaagccgccggcaacttgattgaacaaggtatcgat
gcattggtcgtttgtggtggtgatggttctttaactggtgccgatctatttagacatgaa
tggccttctttagtggaagatttggttaaggatggaagattcaccgaagaacaagtcact
ccatacagaaacttaaagattgttggtcttgttggttccatcgataacgatatgtctggt
actgattccaccattggtgcttactccgctttggaaagaatttgtgaaatggttgattac
attgatgctaccgctaaatctcattctcgtgccttcgtcgttgaagttatggggagacat
tgtggttggttagctttgatggctggtattgctaccggtgctgattatatcttcattcca
gaaagagctgtcccacatggccaatggcaagatgaattgaaggaagtttgtcaaagacat
agagctaagggtagaagaaataacactattattgttgctgaaggtgccattgacgatcaa
ttgaatccagttacttgtgaagacgttaagaatgtcttgatcgaattaggtttggatact
aaagttaccatcttgggtcacgttcaaagagggggtactgctgtcgctcacgacagatgg
ttggccactttacaaggtgtggatgccgttaaggccatcttggaaatgactccagaaact
ccatctccattgattggtatcttggaaaacaagatcattagaatgccattagtggaatcc
gttaaattaactcaatccgtcgctgccgcaattgaaagtaaaaactttgacaaggctatt
tctctaagagacactgaattcattgaattatacgaaaacttcttatctaccactgtgaag
gatgacggttctgaaatgttgcctgtcactgaaagattaaacattggtatcgtccatgtc
ggtgctccatcagctgccctaaatgctgctactcgtgctgcaactctatactgtttgtct
cacggtcatactccaattgctatcatgaatgggttcagtggtttgattcaaaccggtgaa
gttaagaagatggaatggattgatgttgaaaactggcacaatttgggtggttctgaaatc
ggtactaacagatctgttgccgctgaagatttaggtactattgcatactatttccaaaag
attaaattagatggtttaattattcttggtgggtttgaaggtttcaaatctttgaaacaa
ttacgtgatggtagatctcaacatccaatctttaacattccaatgactttgatcccatct
actatctctaacaatgttccaggtactgaatactctctaggtgttgacacttgtttgaac
gctttagttaaatacactgatgatatcaagcaaagtgcttccgctacaagaagaagagtt
ttcgttgtcgaagttcaaggtggtcattcaggttatatcgcctctttcaccggtttaatc
actggtgcagtctccatctatactccagaagataagattaacctatcaagcatccaagaa
gatttgactttgttagaagaaaacttccgtcatgaccaaggtgaaaacagaaatggtaag
atattaatcagaaacgaacaagcctccagtgtatacagcactgaattgattgcaaacctt
atttctgaatcatgtcacggtagattcggtgttagaaccgctatcccaggtcatgctcaa
caaggtggtgttccatcttctaaggatcgtgtcgttgcttctagatttgctgtcaaatgt
atcaaatttattgaacaatggaacaagaacaaccaagccccaggtactaatactgattct
aagatcttaagatttaagtttgatgctcaaggtgaaaaggtcccaactattgaacacgaa
gatgattccgctgctgtgatctgtgttaacggttctagtatcagtttcaagccaattgct
ggtttgtgggaaaatgaaactaatgttgaattaagaaagggtcaagaagttcattggact
gaatataacaagatcagtgacattctttccggtagaatgaaattgagagatgaagttgct
gccctagctgctgaatctaattaa

DBGET integrated database retrieval system