KEGG   Naumovozyma castellii: NCAS_0F00650Help
Entry
NCAS_0F00650      CDS       T02233                                 

Gene name
NCAS0F00650
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ncs  Naumovozyma castellii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NCAS_0F00650 (NCAS0F00650)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCAS_0F00650 (NCAS0F00650)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCAS_0F00650 (NCAS0F00650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:126598..127083
Genome map
AA seq 161 aa AA seqDB search
MSEFYKLTPKDKKGEDYPFSQLKGKVVLIVNVASKCGFTPQYKELEALYEKYNDKGLVII
GFPCNQFGHQEPGTDEEIGQFCQLNYGVTFPIMKKIDVNGKNEDPVYGFLKSQKSGILGF
KGIKWNFEKFLVDKNGKVYERYASLTKPSSIDETIATLLKE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattctataagctaactccaaaggataagaagggggaagactaccccttctca
caactaaagggcaaagtcgtcctgatagtgaacgttgcctccaagtgtgggtttactccg
caatacaaggaattagaagctttatatgagaagtataacgataaaggtttggttatcatc
gggttcccatgtaatcagttcggtcatcaagaaccgggcactgatgaagagattggacaa
ttctgtcaattgaattatggtgtcacttttccaattatgaagaagattgatgttaatggg
aagaatgaagatcctgtttatggcttcttaaagtctcaaaaatcaggaattttggggttt
aaaggtatcaaatggaatttcgaaaaatttttggtcgataagaatggaaaagtttatgaa
aggtatgcctctttgactaaaccttcttctattgatgaaactattgctactcttctaaag
gaatga

DBGET integrated database retrieval system