KEGG   Naumovozyma castellii: NCAS_0F00650Help
Entry
NCAS_0F00650      CDS       T02233                                 

Gene name
NCAS0F00650
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ncs  Naumovozyma castellii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ncs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ncs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:126598..127083
Genome map
AA seq 161 aa AA seqDB search
MSEFYKLTPKDKKGEDYPFSQLKGKVVLIVNVASKCGFTPQYKELEALYEKYNDKGLVII
GFPCNQFGHQEPGTDEEIGQFCQLNYGVTFPIMKKIDVNGKNEDPVYGFLKSQKSGILGF
KGIKWNFEKFLVDKNGKVYERYASLTKPSSIDETIATLLKE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattctataagctaactccaaaggataagaagggggaagactaccccttctca
caactaaagggcaaagtcgtcctgatagtgaacgttgcctccaagtgtgggtttactccg
caatacaaggaattagaagctttatatgagaagtataacgataaaggtttggttatcatc
gggttcccatgtaatcagttcggtcatcaagaaccgggcactgatgaagagattggacaa
ttctgtcaattgaattatggtgtcacttttccaattatgaagaagattgatgttaatggg
aagaatgaagatcctgtttatggcttcttaaagtctcaaaaatcaggaattttggggttt
aaaggtatcaaatggaatttcgaaaaatttttggtcgataagaatggaaaagtttatgaa
aggtatgcctctttgactaaaccttcttctattgatgaaactattgctactcttctaaag
gaatga

DBGET integrated database retrieval system