KEGG   Naumovozyma castellii: NCAS_0F00990Help
Entry
NCAS_0F00990      CDS       T02233                                 

Gene name
NCAS0F00990
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ncs  Naumovozyma castellii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ncs00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(196638..197174)
Genome map
AA seq 178 aa AA seqDB search
MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT
VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP
GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQMSVRKQYLESIGN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcttacgtgcatgataatgacaataagattgattttagagaaccccataat
tcaggggtcgctgtgtcattagaacgattggcaaaattaggaatagtagccaagtatttg
gaaaagattgacgatgttgaattacttgcaaaggaaagaaactacaagaacagggatact
gttaaattgagtaaaaagacattcaataatgacgaaactctattattgaatcaactaaat
atcttctatcaagagcatttgcatgaagatgaggaaattcgttactgtatcgaaggatct
ggatactttgacatcaaagatacgtttacaaatgaatggattcgttgcaaagtttcccct
ggtgatctattaattgtccctgctggtatatatcataggtttacattaacaacagataat
tttattaaggcgttacgattatttaaagatgaacccaaatggcaagctcataataaatca
ggagatactgaccaaatgtcagttagaaaacaatacctagaatccattggaaactaa

DBGET integrated database retrieval system