KEGG   Naumovozyma castellii: NCAS_0F01340Help
Entry
NCAS_0F01340      CDS       T02233                                 

Gene name
NCAS0F01340
Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00230  Purine metabolism
ncs01100  Metabolic pathways
Module
ncs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCAS_0F01340 (NCAS0F01340)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NCAS_0F01340 (NCAS0F01340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_22 MMR_HSR1 AAA_18 AAA_24 ABC_tran RNA_helicase AAA_28 AAA_30 DUF2075 RsgA_GTPase AAA AAA_14 AAA_29 NACHT AAA_2 Viral_helicase1 T2SSE ATPase_2 AAA_19 cobW NTPase_1 dNK KAP_NTPase Rad17 AAA_25 TsaE Adeno_IVa2 MobB AAA_17 Roc NB-ARC Cytidylate_kin AAA_5 AAA_23
Motif
Other DBs
NCBI-GeneID: 11527530
NCBI-ProteinID: XP_003676973
UniProt: G0VGJ7
Position
6:complement(257024..257584)
Genome map
AA seq 186 aa AA seqDB search
MSSVIVISGPSGTGKSTLLKKLFAEYPDTFGFSVSSTTRSPREGEVHGKDYNFATVDEFK
KMIDEDAFIEWAQFSGNYYGTTVASVKKVISSGKTCILDIDMQGVKSVKSKPELKARYLF
IAPPSVDDLRKRLEGRGTETEESLNKRLAAATAELEYAESGAHDQIIVNDDLDKAYNELK
EFIFQK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtgttattgtcatttctggtccaagtggtacaggtaagtccactcttttgaaa
aagttgtttgctgaatacccagacactttcggtttcagcgtttcatccactaccagatct
ccaagagaaggtgaagttcatggtaaggattacaattttgccaccgttgatgaattcaaa
aagatgattgatgaagatgcatttattgaatgggcccaattctctggtaactactacggt
accaccgtggcatctgtcaaaaaggttatttcctctggtaagacatgtatcttggatatt
gatatgcaaggtgtcaaatccgttaaaagcaaacctgaattgaaggccagatacttgttc
attgcacctccatccgtggacgatttgagaaaaagattggaaggcagaggtactgaaaca
gaggaatctttgaacaagagacttgctgctgccactgctgaattagaatatgcggaatca
ggtgcccatgatcaaatcatcgtcaatgatgatttagacaaggcatacaatgagttgaaa
gaattcattttccaaaaataa

DBGET integrated database retrieval system