KEGG   Naumovozyma castellii: NCAS_0F01340Help
Entry
NCAS_0F01340      CDS       T02233                                 

Gene name
NCAS0F01340
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ncs  Naumovozyma castellii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCAS_0F01340 (NCAS0F01340)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NCAS_0F01340 (NCAS0F01340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(257024..257584)
Genome map
AA seq 186 aa AA seqDB search
MSSVIVISGPSGTGKSTLLKKLFAEYPDTFGFSVSSTTRSPREGEVHGKDYNFATVDEFK
KMIDEDAFIEWAQFSGNYYGTTVASVKKVISSGKTCILDIDMQGVKSVKSKPELKARYLF
IAPPSVDDLRKRLEGRGTETEESLNKRLAAATAELEYAESGAHDQIIVNDDLDKAYNELK
EFIFQK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtgttattgtcatttctggtccaagtggtacaggtaagtccactcttttgaaa
aagttgtttgctgaatacccagacactttcggtttcagcgtttcatccactaccagatct
ccaagagaaggtgaagttcatggtaaggattacaattttgccaccgttgatgaattcaaa
aagatgattgatgaagatgcatttattgaatgggcccaattctctggtaactactacggt
accaccgtggcatctgtcaaaaaggttatttcctctggtaagacatgtatcttggatatt
gatatgcaaggtgtcaaatccgttaaaagcaaacctgaattgaaggccagatacttgttc
attgcacctccatccgtggacgatttgagaaaaagattggaaggcagaggtactgaaaca
gaggaatctttgaacaagagacttgctgctgccactgctgaattagaatatgcggaatca
ggtgcccatgatcaaatcatcgtcaatgatgatttagacaaggcatacaatgagttgaaa
gaattcattttccaaaaataa

DBGET integrated database retrieval system