KEGG   Naumovozyma castellii: NCAS_0F01420Help
Entry
NCAS_0F01420      CDS       T02233                                 

Gene name
NCAS0F01420
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0F01420 (NCAS0F01420)
Enzymes [BR:ncs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NCAS_0F01420 (NCAS0F01420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:281938..282828
Genome map
AA seq 296 aa AA seqDB search
MPIQNNDSEVILTHPKNSQSSVTILKYGATVYSWKINGVEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNETDPLLSKLPQHGLARNSTWEFLGQVKEDPPTIQFGLNKEIANPELTKLW
PQDFQLVLTVELGVDFLKTSIEVDNTSNSEELKFNWLFHTYLRIEDIEDTMVSNLAGMNF
YDQLIKESMVDKHPVVTFHQETDVIYKNVNADRVIQVVNRGKPIHTLKRENLPDAVVWNP
WVKKSEGMGDFEPKSGYKNMVCVEPGHVHDFVVLAPGKKWNASQLLYKDALNYQAI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccaaaataacgattcagaagttatcttaactcatcctaaaaatagccaaagt
tccgtcactatcttgaagtacggtgctacagtttactcctggaaaattaatggtgttgaa
caattatggttgtctactgcagccaagttagatggttccaaaccagttagaggtggtatc
ccattagtctttcctgtgtttggtaagaatgaaactgacccattattaagcaaattgcca
caacatgggttagcaagaaactccacttgggaatttcttgggcaagtcaaggaggaccca
ccaaccattcaattcggtttaaataaggaaattgccaatcctgaactaaccaaattgtgg
ccacaggacttccaattggttttgactgtggaattgggtgttgatttcttgaagactagt
atcgaggtggacaacacttctaactctgaagaattgaaattcaactggttattccacacc
tatttaagaattgaagacattgaagacacaatggtttcaaacttggctggaatgaacttt
tatgatcaattaattaaggaaagcatggttgataaacatcctgtcgttactttccatcaa
gaaactgatgtcatctacaagaatgtgaatgctgaccgtgtgatccaagtggtcaacaga
ggtaaaccaattcatactttgaagagagaaaacttaccagacgcggtggtttggaatcca
tgggtcaagaaatccgaaggcatgggtgatttcgaaccaaaatctggttacaagaatatg
gtttgtgtagaaccaggccatgttcatgattttgtggttttggcaccaggtaaaaagtgg
aatgcgtctcaattgttatacaaagatgccttgaactaccaagccatttaa

DBGET integrated database retrieval system