KEGG   Naumovozyma castellii: NCAS_0F02050Help
Entry
NCAS_0F02050      CDS       T02233                                 

Gene name
NCAS0F02050
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(409352..413923)
Genome map
AA seq 1523 aa AA seqDB search
MPVTYGPQPLKPLNTQMRHGFEEQYDTQFIQSLVNNFIFYFDDKRHRTNGNPIPQAIKLQ
DKDHYYQTISDWKIMKDRQKTVSAALLLCLNLGVDPPDLVKTHPCARMESWVDPLNFQDS
KKAIEQIGKNLQSQYETLSLRCRYKQSLDPCVEDVKRFCNSLRRSSKDDRILFHYNGHGV
PQPTPSGEIWVFNRGYTQYIPVSIYDLQSWLGAPCVYVYDCNSAGNIVTNFQKFVQKRIK
DDQEGNHDAAAPSPTAAYLQCFQLASCRANELLLMSPELPADLFTCCLTCPIEISIRIFL
MQSPLKHSKYKIFFESTSNDSNTESFKANVPTVSIPGVLSDRRTPLGELNWIFTAVTDTI
AWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPISDPELPDSIADHPMWKSW
DLAMDEVLGKLVTELKNSPPTSDLEKQLILQQNDVNSGITQQSAKVQPGKQKIQPESIQT
QSKFAVSNLSTISLVNHPALQNQGKKVQNVVLPSNSQQSQQQQQQQQQFTGFFEQNLTAF
ELWLKYASNSRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYV
LKLLQSPAPELKPILVFIWARIMSIDYKNTQAELIKERGYIYFISILVPEWGYNLTPSRS
TSFINGVPMTPTTPTTPSLPMGAQPPHANDTTDEQKAMAVFVLASFVRDYKPGQKLCFSL
ELITKLSFYIDNSDIPLLRQWCILLIGLLYIQNPLNKFMCMNNGTLETLLLTLKDPVPEV
RTAVILTLKHFISDLDDADIIIRTQQEYEQQISQIHAQLQQLQNSPQQQQHNVEQQQLKL
EQQLNHIQLMESQLENVELIKLKQQELSNLIATLALINDGSPLVRKEVIIFFSQIVYRYT
NFFLVVVFNELTDEISQLEGKDMEQSKPNYGENRHSVSHGSVFSTVWKALLILAEDPYLE
NKKMAEQVVDYILLELSSQNELGSVFGKIEHYLVKRSTQMTGTTNLNFNATQIQIGKNTL
RQFNKNKETDSSLNNNTNNLNSNDPDRFVTLSRLFKKLGFGEPTLESDSVRAKKPSNIHL
LGAAYGTSYTVQTPFFLEHKEQLPLPLESRFFDYSCEYFQEPQMRKPESDEVGSLEYNSR
LWRRNRNEKIIEETQKQKKLSLYGNWNNKIAILDNKTQPKVLKFTQFEDYLVSADDRDNI
TVFDWENKTRLNRFSNSNPFGTKITDLKFLNEDDITLLLTASSDGIIKVYRNFQSKDDVQ
EISACRALTDMLLAPRSSGLLTEWQQIRGSLLATGDVKIIRVWDAHTETVEVDIPAKTSS
LITALTSDQLAGDIFTAGFADGSLRVYDRRMDSRDSMVRRWRAGNGVHGTWINNVHLQRG
GYRELVSSTTNGVVQLWDIRSQEPVQTFVDENSHGNQKKDTTMTCMQVHEHAPIIATGTR
QLKIWTTSGDLIANFKNNRGVSGGMANTLAASGIGSSLSYSGSSNSFLSSMTFHPHRMLL
ATNNSHDASISVYKCQDKKVAEY
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaacatacggcccacaaccacttaaaccattgaacacacaaatgaggcacggg
tttgaggaacaatatgacactcaatttattcaatcattagtgaacaacttcatcttttac
ttcgacgataagagacaccgtaccaatgggaacccgataccgcaggccataaaactacaa
gacaaggaccattattatcaaactatatccgattggaaaataatgaaagatagacagaag
actgtcagtgcggctcttttgctctgtttgaatttgggagtggatcctccagatttggta
aaaactcatccttgtgcacggatggaatcatgggtagatccactcaatttccaggactct
aagaaggccattgaacaaatcgggaagaacctgcaatcacaatatgaaactctatctctg
cggtgtagatataagcaaagtttagatccttgtgtggaagatgtaaaacggttttgtaac
tctctaagaaggagttccaaagatgataggatcttattccattacaatggtcacggtgtg
ccacaaccaacaccttctggggaaatttgggtatttaatagaggttatacacaatatatt
ccagtttccatctatgatttacaaagttggttgggtgcaccttgtgtttatgtctatgat
tgtaatagtgcaggaaacatagtcaccaattttcaaaaattcgttcaaaaaagaattaaa
gatgatcaagaaggtaatcatgatgcagcagctccatccccaactgctgcatatttgcaa
tgttttcaattggcatcatgtagagctaatgaattattattaatgagtcctgaactccct
gcagatttattcacttgctgtctaacatgccctatcgaaattagtatacgaatattctta
atgcaatcacctctaaaacattcaaaatacaagatattttttgaatccacatccaatgac
agtaataccgagtcttttaaagcaaatgttcccacagtttcaataccaggtgtattatca
gatagaaggacgcctttgggggaacttaattggatttttacggcagtgacagatactata
gcatggacatcattaccaagaccactatttaaaaagttgtttagacatgatttgatgatt
gcagctttatttagaaattttcttttggcaaagaggataatgccatggtataactgtcat
cccatatcggaccccgaattgcctgattccattgcagatcatccaatgtggaaatcctgg
gatttagctatggatgaagtattaggcaagttagttaccgaactgaaaaattcaccacct
acatcagatctggaaaaacaattgattcttcaacaaaatgatgtcaattcaggcataacc
caacaatcagcaaaggtacaacctgggaaacaaaaaatacagccggaaagtatccaaaca
caatcaaagttcgcagtcagcaatttaagtaccatttcattagtaaaccatcccgcgctg
caaaatcaaggaaagaaagtgcaaaatgttgtattaccatcaaattcccaacaatcacag
cagcaacagcagcaacaacagcagtttacgggatttttcgaacaaaatttaaccgcattt
gaactttggctgaagtatgcctctaattcaaggcatccaccagaacaattacctattgtt
ttacaagtcttactttctcaagtgcatcgtattagagcattggttctactctctcgattt
ttggatttaggtccatgggctgtctatctttcgttgtctataggtatcttcccttatgtt
ttgaaacttctacaaagccctgctcccgaattgaaaccaattttggtattcatttgggca
agaataatgtcaattgattacaaaaatactcaagctgagttgatcaaagaaagaggatac
atatattttatcagtatactagttccagaatggggatataatctaactccatcaaggtcg
acttcatttataaatggagtacctatgactccgactactccaactactccaagtttgcct
atgggagcgcagccaccacatgcaaacgatacaacagatgaacaaaaggctatggcagta
tttgttctagcatcttttgttagagattataaaccaggccagaagttatgtttcagttta
gaacttattactaaattatccttctacattgataactcagatatccccttgttgagacaa
tggtgtatacttctcattgggttactatatattcaaaatccattgaataaatttatgtgt
atgaacaatggaactctcgaaaccttacttctaactttaaaagacccagttcctgaagtg
agaacagccgtcatattaactttaaaacatttcatttctgatttggatgacgctgatata
ataatccgtacacaacaagaatatgagcaacaaatttcccaaattcatgctcaactacaa
caattacaaaattcacctcaacaacaacagcataatgttgaacaacaacaattaaagttg
gaacaacaattgaatcatattcagttaatggaatctcaattggaaaatgtggagttaatc
aaattgaaacaacaagaattatcaaatctgattgccacattagccttaataaatgatgga
tccccattagtgagaaaggaagtcatcatttttttttcacaaatcgtttaccgttacaca
aatttcttcctcgttgttgtcttcaacgaattgacagatgaaattagccaattagaagga
aaggatatggaacaatcgaaaccaaattatggagaaaatagacactcagtaagtcatggt
tctgtatttagtactgtttggaaggcattattaatcttagccgaggatccatatcttgaa
aataaaaaaatggctgaacaagttgtggattatatcttgttggaattaagctcacagaat
gaattgggttcagtatttggtaagattgaacattatttagtgaagagaagtacacagatg
acaggtaccacaaatcttaatttcaatgcaacacaaattcaaattgggaaaaatacttta
cgtcagttcaataagaacaaagaaactgattcttccttgaataataacaccaataattta
aactctaatgatccagacagatttgttacactatctagactatttaagaagctagggttt
ggtgaacctactcttgaaagtgatagtgtgagagccaaaaaaccatcaaatatacattta
ttaggtgccgcatacggtacatcttatacggttcagactccttttttccttgaacataaa
gaacaattacctctcccattggaaagtaggttttttgactattcatgtgaatattttcaa
gaaccgcaaatgagaaaaccagaatctgatgaagttggaagtctagaatataattccaga
ctttggagaagaaacagaaatgaaaaaataattgaagaaactcaaaaacaaaaaaaacta
tcattatacggtaactggaataataagatagcgatacttgataacaaaactcaaccaaaa
gtattaaaatttactcagtttgaggattatttagtatcggcagatgatcgtgataatata
actgtattcgactgggaaaataaaaccagattaaacagattttctaacagtaatccattt
ggcacaaaaataacagatctcaaatttttaaatgaggacgatataactcttttgttgaca
gcatcatccgatgggataattaaagtatacaggaatttccagtcaaaagatgatgtccag
gaaatttcagcatgtagggccctgactgatatgttactagcaccaaggtctagtggtctc
ttaacggaatggcaacaaattcgaggatctcttctggctactggtgatgttaaaataatt
agagtttgggatgctcatacagaaactgttgaagtagatattccagcgaaaacttcttct
ttaattacagccttaacctctgatcaattggcgggtgacatttttacagctgggtttgca
gatggttctttaagggtatatgaccgcagaatggattcaagagattcgatggttcgtcgt
tggagggcggggaatggtgtgcatggaacgtggataaataatgtccatcttcaaagaggt
ggctatagagagctggtgagcagtacaacgaatggtgtcgttcaattgtgggatatcaga
tcccaagaacctgttcagacatttgttgatgaaaattcccatgggaatcaaaaaaaggat
accacgatgacttgcatgcaagttcatgaacatgctccaatcattgccaccggaacaaga
cagcttaagatatggacaacgtctggtgatcttattgcaaatttcaagaataatcgtggt
gtaagtggaggtatggcgaatactctagcggcatcaggaattggctcttctttgtcctat
tctggatcatctaattctttcttatcttctatgacgttccaccctcatagaatgctgctt
gcaacgaacaattcacatgatgctagtattagtgtttataaatgtcaggataaaaaggta
gccgaatattga

DBGET integrated database retrieval system