KEGG   Naumovozyma castellii: NCAS_0F02050Help
Entry
NCAS_0F02050      CDS       T02233                                 

Gene name
NCAS0F02050
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ncs  Naumovozyma castellii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(409352..413923)
Genome map
AA seq 1523 aa AA seqDB search
MPVTYGPQPLKPLNTQMRHGFEEQYDTQFIQSLVNNFIFYFDDKRHRTNGNPIPQAIKLQ
DKDHYYQTISDWKIMKDRQKTVSAALLLCLNLGVDPPDLVKTHPCARMESWVDPLNFQDS
KKAIEQIGKNLQSQYETLSLRCRYKQSLDPCVEDVKRFCNSLRRSSKDDRILFHYNGHGV
PQPTPSGEIWVFNRGYTQYIPVSIYDLQSWLGAPCVYVYDCNSAGNIVTNFQKFVQKRIK
DDQEGNHDAAAPSPTAAYLQCFQLASCRANELLLMSPELPADLFTCCLTCPIEISIRIFL
MQSPLKHSKYKIFFESTSNDSNTESFKANVPTVSIPGVLSDRRTPLGELNWIFTAVTDTI
AWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPISDPELPDSIADHPMWKSW
DLAMDEVLGKLVTELKNSPPTSDLEKQLILQQNDVNSGITQQSAKVQPGKQKIQPESIQT
QSKFAVSNLSTISLVNHPALQNQGKKVQNVVLPSNSQQSQQQQQQQQQFTGFFEQNLTAF
ELWLKYASNSRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYV
LKLLQSPAPELKPILVFIWARIMSIDYKNTQAELIKERGYIYFISILVPEWGYNLTPSRS
TSFINGVPMTPTTPTTPSLPMGAQPPHANDTTDEQKAMAVFVLASFVRDYKPGQKLCFSL
ELITKLSFYIDNSDIPLLRQWCILLIGLLYIQNPLNKFMCMNNGTLETLLLTLKDPVPEV
RTAVILTLKHFISDLDDADIIIRTQQEYEQQISQIHAQLQQLQNSPQQQQHNVEQQQLKL
EQQLNHIQLMESQLENVELIKLKQQELSNLIATLALINDGSPLVRKEVIIFFSQIVYRYT
NFFLVVVFNELTDEISQLEGKDMEQSKPNYGENRHSVSHGSVFSTVWKALLILAEDPYLE
NKKMAEQVVDYILLELSSQNELGSVFGKIEHYLVKRSTQMTGTTNLNFNATQIQIGKNTL
RQFNKNKETDSSLNNNTNNLNSNDPDRFVTLSRLFKKLGFGEPTLESDSVRAKKPSNIHL
LGAAYGTSYTVQTPFFLEHKEQLPLPLESRFFDYSCEYFQEPQMRKPESDEVGSLEYNSR
LWRRNRNEKIIEETQKQKKLSLYGNWNNKIAILDNKTQPKVLKFTQFEDYLVSADDRDNI
TVFDWENKTRLNRFSNSNPFGTKITDLKFLNEDDITLLLTASSDGIIKVYRNFQSKDDVQ
EISACRALTDMLLAPRSSGLLTEWQQIRGSLLATGDVKIIRVWDAHTETVEVDIPAKTSS
LITALTSDQLAGDIFTAGFADGSLRVYDRRMDSRDSMVRRWRAGNGVHGTWINNVHLQRG
GYRELVSSTTNGVVQLWDIRSQEPVQTFVDENSHGNQKKDTTMTCMQVHEHAPIIATGTR
QLKIWTTSGDLIANFKNNRGVSGGMANTLAASGIGSSLSYSGSSNSFLSSMTFHPHRMLL
ATNNSHDASISVYKCQDKKVAEY
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaacatacggcccacaaccacttaaaccattgaacacacaaatgaggcacggg
tttgaggaacaatatgacactcaatttattcaatcattagtgaacaacttcatcttttac
ttcgacgataagagacaccgtaccaatgggaacccgataccgcaggccataaaactacaa
gacaaggaccattattatcaaactatatccgattggaaaataatgaaagatagacagaag
actgtcagtgcggctcttttgctctgtttgaatttgggagtggatcctccagatttggta
aaaactcatccttgtgcacggatggaatcatgggtagatccactcaatttccaggactct
aagaaggccattgaacaaatcgggaagaacctgcaatcacaatatgaaactctatctctg
cggtgtagatataagcaaagtttagatccttgtgtggaagatgtaaaacggttttgtaac
tctctaagaaggagttccaaagatgataggatcttattccattacaatggtcacggtgtg
ccacaaccaacaccttctggggaaatttgggtatttaatagaggttatacacaatatatt
ccagtttccatctatgatttacaaagttggttgggtgcaccttgtgtttatgtctatgat
tgtaatagtgcaggaaacatagtcaccaattttcaaaaattcgttcaaaaaagaattaaa
gatgatcaagaaggtaatcatgatgcagcagctccatccccaactgctgcatatttgcaa
tgttttcaattggcatcatgtagagctaatgaattattattaatgagtcctgaactccct
gcagatttattcacttgctgtctaacatgccctatcgaaattagtatacgaatattctta
atgcaatcacctctaaaacattcaaaatacaagatattttttgaatccacatccaatgac
agtaataccgagtcttttaaagcaaatgttcccacagtttcaataccaggtgtattatca
gatagaaggacgcctttgggggaacttaattggatttttacggcagtgacagatactata
gcatggacatcattaccaagaccactatttaaaaagttgtttagacatgatttgatgatt
gcagctttatttagaaattttcttttggcaaagaggataatgccatggtataactgtcat
cccatatcggaccccgaattgcctgattccattgcagatcatccaatgtggaaatcctgg
gatttagctatggatgaagtattaggcaagttagttaccgaactgaaaaattcaccacct
acatcagatctggaaaaacaattgattcttcaacaaaatgatgtcaattcaggcataacc
caacaatcagcaaaggtacaacctgggaaacaaaaaatacagccggaaagtatccaaaca
caatcaaagttcgcagtcagcaatttaagtaccatttcattagtaaaccatcccgcgctg
caaaatcaaggaaagaaagtgcaaaatgttgtattaccatcaaattcccaacaatcacag
cagcaacagcagcaacaacagcagtttacgggatttttcgaacaaaatttaaccgcattt
gaactttggctgaagtatgcctctaattcaaggcatccaccagaacaattacctattgtt
ttacaagtcttactttctcaagtgcatcgtattagagcattggttctactctctcgattt
ttggatttaggtccatgggctgtctatctttcgttgtctataggtatcttcccttatgtt
ttgaaacttctacaaagccctgctcccgaattgaaaccaattttggtattcatttgggca
agaataatgtcaattgattacaaaaatactcaagctgagttgatcaaagaaagaggatac
atatattttatcagtatactagttccagaatggggatataatctaactccatcaaggtcg
acttcatttataaatggagtacctatgactccgactactccaactactccaagtttgcct
atgggagcgcagccaccacatgcaaacgatacaacagatgaacaaaaggctatggcagta
tttgttctagcatcttttgttagagattataaaccaggccagaagttatgtttcagttta
gaacttattactaaattatccttctacattgataactcagatatccccttgttgagacaa
tggtgtatacttctcattgggttactatatattcaaaatccattgaataaatttatgtgt
atgaacaatggaactctcgaaaccttacttctaactttaaaagacccagttcctgaagtg
agaacagccgtcatattaactttaaaacatttcatttctgatttggatgacgctgatata
ataatccgtacacaacaagaatatgagcaacaaatttcccaaattcatgctcaactacaa
caattacaaaattcacctcaacaacaacagcataatgttgaacaacaacaattaaagttg
gaacaacaattgaatcatattcagttaatggaatctcaattggaaaatgtggagttaatc
aaattgaaacaacaagaattatcaaatctgattgccacattagccttaataaatgatgga
tccccattagtgagaaaggaagtcatcatttttttttcacaaatcgtttaccgttacaca
aatttcttcctcgttgttgtcttcaacgaattgacagatgaaattagccaattagaagga
aaggatatggaacaatcgaaaccaaattatggagaaaatagacactcagtaagtcatggt
tctgtatttagtactgtttggaaggcattattaatcttagccgaggatccatatcttgaa
aataaaaaaatggctgaacaagttgtggattatatcttgttggaattaagctcacagaat
gaattgggttcagtatttggtaagattgaacattatttagtgaagagaagtacacagatg
acaggtaccacaaatcttaatttcaatgcaacacaaattcaaattgggaaaaatacttta
cgtcagttcaataagaacaaagaaactgattcttccttgaataataacaccaataattta
aactctaatgatccagacagatttgttacactatctagactatttaagaagctagggttt
ggtgaacctactcttgaaagtgatagtgtgagagccaaaaaaccatcaaatatacattta
ttaggtgccgcatacggtacatcttatacggttcagactccttttttccttgaacataaa
gaacaattacctctcccattggaaagtaggttttttgactattcatgtgaatattttcaa
gaaccgcaaatgagaaaaccagaatctgatgaagttggaagtctagaatataattccaga
ctttggagaagaaacagaaatgaaaaaataattgaagaaactcaaaaacaaaaaaaacta
tcattatacggtaactggaataataagatagcgatacttgataacaaaactcaaccaaaa
gtattaaaatttactcagtttgaggattatttagtatcggcagatgatcgtgataatata
actgtattcgactgggaaaataaaaccagattaaacagattttctaacagtaatccattt
ggcacaaaaataacagatctcaaatttttaaatgaggacgatataactcttttgttgaca
gcatcatccgatgggataattaaagtatacaggaatttccagtcaaaagatgatgtccag
gaaatttcagcatgtagggccctgactgatatgttactagcaccaaggtctagtggtctc
ttaacggaatggcaacaaattcgaggatctcttctggctactggtgatgttaaaataatt
agagtttgggatgctcatacagaaactgttgaagtagatattccagcgaaaacttcttct
ttaattacagccttaacctctgatcaattggcgggtgacatttttacagctgggtttgca
gatggttctttaagggtatatgaccgcagaatggattcaagagattcgatggttcgtcgt
tggagggcggggaatggtgtgcatggaacgtggataaataatgtccatcttcaaagaggt
ggctatagagagctggtgagcagtacaacgaatggtgtcgttcaattgtgggatatcaga
tcccaagaacctgttcagacatttgttgatgaaaattcccatgggaatcaaaaaaaggat
accacgatgacttgcatgcaagttcatgaacatgctccaatcattgccaccggaacaaga
cagcttaagatatggacaacgtctggtgatcttattgcaaatttcaagaataatcgtggt
gtaagtggaggtatggcgaatactctagcggcatcaggaattggctcttctttgtcctat
tctggatcatctaattctttcttatcttctatgacgttccaccctcatagaatgctgctt
gcaacgaacaattcacatgatgctagtattagtgtttataaatgtcaggataaaaaggta
gccgaatattga

DBGET integrated database retrieval system