KEGG   Naumovozyma castellii: NCAS_0F02460Help
Entry
NCAS_0F02460      CDS       T02233                                 

Gene name
NCAS0F02460
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(485697..487739)
Genome map
AA seq 680 aa AA seqDB search
MNSTDLIVVVVLVALFLLYKYLETIKELIFSNDDAISAVNSSSRDIAHVLTENNKNYLVL
FGSQTGTAEDYAKKFAKELTAKFDLNVLCGDLELYDYGSLNELPENVIVSIFMSTYGEGD
FPDGAVKFENFISTASESSLENLRFTVFGLGNSTYEFYNGAARKVQKYLQAAGASLLGSI
GEGDDATGSTDEDYLTWKELIMGELKNVLSLDEQEQKFKPSFQLEILDTIDSNTSLGEPT
KNYLPSALLKGEINGPFSISEPYLGHISNSRELFKSDDRNCIHSEFDISNTNLTYSTGDH
LGIWPSNANEKVEQFLVAFNLNPETIFNMRQLDPTIKVPFPLPTTIGAAVRYYMEITGPV
SRQFFGHLIQFAPNNDIKEKLTILSNDKNKFQTEITSKFFNIADAILYLSGGIKWETVPW
GFLIETIPHLLPRYYSISSSSSLDKDSIHVTSVVENSIEPKSNTNVVGVTTNLLRNIQLA
ENKMLGSESNPLPVHYDLNGPRDLFRDYKLPIHVRKSTFRLPTNPSAPVIMIGPGTGVAP
FRGFVRDRVNLLESDRSIKLGKHLLFYGCRNEDDYLYREEWIQYATILGESFEMNVAFSR
VPGTPKIYVQDKLREQSKLIWQLIQDGAFLYVCGDAGRMAKDVHKTLLDIVMKEKGVSED
DAIEVIKMLKTSNRYQEDIW
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcacagatttgatcgtggtcgtggtactcgttgcattgttcctgctatacaaa
tatctagaaacaatcaaggaactcatattttctaatgacgatgcgatctctgctgttaat
tcaagctccagagatattgcgcatgtgttaactgagaacaacaaaaattatttggtttta
tttggctcccaaacaggaactgcagaagattatgccaagaaatttgcaaaggaactaaca
gcaaaatttgatctaaacgttctttgcggtgatctggaattatacgattacggttccttg
aatgaactacctgagaatgttattgtttccatctttatgtccacttatggtgaaggtgat
ttcccagatggggctgtcaagtttgaaaacttcatcagtaccgcaagtgaaagctctctg
gaaaatctgaggttcaccgtttttgggttaggtaactctacctatgagttctataatgga
gctgcaaggaaagtgcagaagtatctacaagcggccggggcaagcttacttggatctatt
ggtgaaggggatgatgctactggttctacagatgaagattatttgacatggaaggaactt
ataatgggagaattgaaaaatgtattgagccttgacgaacaagaacaaaaattcaaaccg
tccttccaattagaaattttggacactattgactcaaatacttctcttggtgaaccaacc
aaaaattatctaccatccgctttgctaaagggggaaataaatggcccatttagtatatct
gagccatatctgggacatatcagtaattctcgagaacttttcaaatcggatgatcgtaat
tgcatacacagtgagtttgatatttcaaacactaatttaacttattccacaggtgatcat
ttgggtatttggccatctaatgcgaatgaaaaagtagaacagttcttagtcgctttcaat
ttaaatcctgaaacaatctttaatatgagacaattggatccaactatcaaagtaccattc
ccattgccaacaactataggtgcagctgttagatattacatggaaattacaggcccagta
tccagacaattttttggccatttgatccaatttgcgcccaacaatgatatcaaagagaaa
ctaacaatcttatctaacgataagaataaatttcaaacagaaatcacttctaaatttttc
aacattgctgatgctatactatatttatcaggtggtatcaagtgggaaactgtaccgtgg
ggattcttgatagagacaatcccacatcttctaccccgttattattccatttcttcgtcc
tcatcattagataaagattctattcatgtcacatcagtggtagagaattcaattgaacct
aaatctaatactaatgtcgttggtgttaccacaaatctattaaggaacattcaattggct
gaaaataaaatgttaggctcagagtcaaacccattaccggttcattatgatttaaatggt
cccagagatttatttagggattataaattgccaatccatgttcgtaaatcaacatttaga
ttaccaaccaatccatctgctcctgttattatgattggaccgggaacaggtgttgctcca
tttagaggatttgtaagagatcgtgtaaatctattagaaagtgaccgcagcatcaaattg
ggaaaacacctcttattttatggttgcagaaatgaggatgattacttgtatagggaggaa
tggattcaatatgccacaatattgggagaatcatttgaaatgaatgttgcattttctaga
gttccaggtacaccaaaaatatatgtccaagataaattgcgggaacaaagtaaactgata
tggcaattaattcaagatggggcattcctctatgtctgtggtgatgcaggaagaatggca
aaagatgttcataaaactttactggacattgtcatgaaagagaagggagtgtcagaagac
gacgctattgaagttataaagatgttaaaaacatctaatagataccaggaagatatttgg
taa

DBGET integrated database retrieval system