KEGG   Naumovozyma castellii: NCAS_0F02670Help
Entry
NCAS_0F02670      CDS       T02233                                 

Gene name
NCAS0F02670
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ncs  Naumovozyma castellii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCAS_0F02670 (NCAS0F02670)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCAS_0F02670 (NCAS0F02670)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NCAS_0F02670 (NCAS0F02670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(540785..542056)
Genome map
AA seq 423 aa AA seqDB search
MTMSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRLGHKVIIVSSGGIAVGL
RTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNA
QNTINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTD
NPRTNPEAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMK
SDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNLH
HLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLG
KRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAF
PPH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtcgaagtgctacacgttagttatcaaactgggatcctcatccttggtagac
gagaaaactaaagagccaaaattggctattatgtccctaatagtggaaactgtggttaaa
ttaagaaggttaggccataaggttattattgtttccagtggaggtattgctgtgggctta
aggactctgaatttggataagagaccaaaacatttggctgaagtgcaggctattgccgcc
gtgggtcaaggacgattgattggaagatgggacttactgttttcccaatttggtcaaaga
atagcacagattttaattacaaggaacgatattgtggattggactcaatataagaacgct
caaaatactattaatgagttgttgaagatgggtgtcgttcctattgttaatgaaaatgat
acattatctatcagcgaaattaagtttggtgataatgatactttgtctgccatcacttct
gcattggtaggtgcggattatttgttccttcttaccgatgtagactgtctttacacggat
aatcctagaacaaatccagaggccaagccaatcctcgtggttccagatttagctaagggt
ttgccaggtgtcaatacatctagtggttccgggtctgatgtcggtacaggtggtatggaa
acaaaattaattgctgctgatttggctactaatgctggtgtgcatactatcattatgaaa
agtgatattccaggaaatattttaaaaatagtggagtatatgcaagctcaagacctggat
acaaataagaaacagaaatatcaaggcgatttaagcagtttacaggataaagagttagcc
accctacaaagcttacacgttccattgcatacaaccttcattgctaatgataatttgcat
catttaaaaaatagagaattttggatcttacatgggttggttacacgagggtcggttatt
attgatcaaggggcctataatgcattgacacgtaagaataaagctggtttattaccagta
ggtatcattgacattgagggtaccttccatgaattggaatgtgtagaccttaaattaggg
aaaaggttaccaaacggtgaactagatccaaacactccccttcaaactgttgggagagca
agatgtaactatactagtctggaattaagtaggatcaagggtttgcaaagtgaacaaatt
gaagaagaattaggttatgcggacagtgagtatgctgcccacagagaaaatttagccttt
cctcctcattaa

DBGET integrated database retrieval system