KEGG   Naumovozyma castellii: NCAS_0F02750Help
Entry
NCAS_0F02750      CDS       T02233                                 

Gene name
NCAS0F02750
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ncs  Naumovozyma castellii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NCAS_0F02750 (NCAS0F02750)
Enzymes [BR:ncs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     NCAS_0F02750 (NCAS0F02750)
Glycosyltransferases [BR:ncs01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   NCAS_0F02750 (NCAS0F02750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:555642..557822
Genome map
AA seq 726 aa AA seqDB search
MVKLLSNRCEYFLSYAFKNINVRSPRQPKKLRRSADIFSQPYLQTEVKPYKYKLKVPSPI
IMTDISTATKKDENASTTMKGPYRSFYPIDLIRKEKVGQLSVIDGILSITVALVTLYIGI
RNIEKEVPLFPKEQDIFASVEYYQKDKFILNSFPPLGIQLYSLLPVGSYSAMRLMSLSAS
SFSLLFLYLAFRRVNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWAS
LKCFSHFSIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIYFWQMIGDVRLSTSH
IVKHTTFQIFCLLVIPMTIFATTLYLQINHSRIDSPEYSQYMSSYYKIFLRSKSPILQPM
EITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWILEYVDDYNK
GPLIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGDSDEFWKIDLVE
GSLIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQSPDPQRAKFQIEFVDNDE
IKNPITLAGLPGYGNYSRCYQYIKLAAELIQREFKYDYMVKLQNDNDENDKVHINKEKWP
IYITGNDTTDLIWLTSSIAVVIVACRFGLQVMNWNPWKIDNGDSSSHLNMKIYHEFAIES
LLGWFVHYYIFLKSSNDHLEIVLYLPSFVFAHLLATETVTAIGQWSQWKCAIILLVYIVT
IKCTIL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttctctctaatagatgtgaatattttttgtcctatgctttcaagaatatc
aatgttagatcgccaagacagccaaaaaaattaagaagatccgctgatattttcagccaa
ccttatttgcaaactgaagtgaaaccatataaatacaaattgaaggttccttctccgata
ataatgactgatattagtaccgctacgaagaaggacgaaaatgcgtctactaccatgaaa
ggcccttatcgaagcttttatcccattgacttgattcgcaaggaaaaggtagggcaactt
tcagtcatcgacggtatattatcaataacagttgcactggtgacattatacatagggatt
cgaaatatagagaaggaagtgcctctctttccaaaagaacaagatatatttgcctcggtg
gaatactatcagaaagataagtttattctaaactcattcccaccattgggaatccaattg
tattcacttctaccagttggttcatactctgctatgagattaatgtctttgagtgccagt
tccttctctttattgtttttatacctggcatttcgaagagtaaatgttccttaccttata
gcactggtatcaacagtatgtatcctttccataccattattccgtaaagaaagtacaaga
atctcattggatacattgcagtggttttggttatcgatctctatttactcatgggcaagt
ttgaaatgtttctctcatttctccattaaatggactatccattcattgatttttgcaatg
tcgattggatgcagcatggcaactaaatacattgggttcgccacctggggttgggcaata
ctaatctcatctatttatttctggcaaatgattggtgacgttagattatcaacaagtcat
atcgttaaacacacaacctttcaaatattttgccttctggttataccaatgacaatattc
gccacaactttatatttacaaatcaatcattctcgtatcgattctcccgaatattcacaa
tacatgtcgtcgtattacaagatatttttaagatccaaatcaccaatcttgcaacccatg
gaaataaccaatggatccatcatcacaatacgtcatttgaactcgctaggaggatattta
acttctccagcaaatgaatcatatccagaaggatctgctgaacaaatagtttcattaact
gatatggagtctaatgttgacaatcaatggatacttgaatatgtagatgattataacaag
ggtcccctaattgactctcaaagaattaaattgagacatcgcactactgggaaattatta
agagcatcttcagctaaaccacctgtaagtgaacaagaatataattcagaggtctcctgt
acaggagattgggattatcatggtgatagtgacgaattctggaaaattgatctggtcgaa
ggttcattaataccatgttggaatattatggagttggataatgtgggccaaatgtgtaca
ttgattagtcatgatactagattacctgattggggcgaatttgaacaggaagtgttttgc
attcaatcacctgatccccaaagagccaagtttcaaatcgaatttgtggataatgacgaa
attaagaatcctattacacttgctggtttaccaggatatggcaattattcaaggtgttat
cagtacattaaattagcagcggagttaatacaaagggaatttaaatatgattatatggtt
aaattacaaaatgataacgatgagaatgataaggtacatatcaataaggaaaaatggccg
atttatatcacaggtaatgatacgactgatctcatatggttaacttcaagcattgctgtt
gtgatcgttgcctgtaggtttggtttacaagtaatgaactggaatccatggaagatcgat
aatggggattcatcatcacatttgaatatgaaaatttatcacgaatttgccattgaaagt
ctattaggttggtttgttcattattacatttttttaaagagttcaaacgatcatcttgag
attgtgttatacttgccgagcttcgtttttgcacatttacttgccaccgaaactgttact
gcaataggtcaatggagccagtggaaatgtgctatcatactcctagtctatattgtcaca
ataaaatgtactattttatag

DBGET integrated database retrieval system