KEGG   Naumovozyma castellii: NCAS_0F03510Help
Entry
NCAS_0F03510      CDS       T02233                                 

Gene name
NCAS0F03510
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ncs  Naumovozyma castellii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCAS_0F03510 (NCAS0F03510)
Enzymes [BR:ncs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NCAS_0F03510 (NCAS0F03510)
Peptidases [BR:ncs01002]
 Cysteine Peptidases
  Family C44
   NCAS_0F03510 (NCAS0F03510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:703369..705096
Genome map
AA seq 575 aa AA seqDB search
MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF
AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV
YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD
LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA
RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK
EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT
AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcgctgccttcagacacgaagacgttaaggcttacaagccaaaggct
ctacaactcaccaagagaatcagacaccgtggtcctgattggtccggtaacgtcgtcaag
aacaccaccatcttggctcacgaaagattgtccatcgtcggtctagactccggtgctcaa
ccaattacctccccatgtggtaactacactttatgtgttaacggtgaaatttataaccat
attcaaatcagagaagaatgcgcagactaccaattcaagactctatccgattgtgaacct
atcatcccactatatttgaagtacgatttagacgctccaaagcatctagacggtatgttc
gcatggtgtctatacgacgctaagcaagaccgtatcgtcgccgctagagatccaatcggt
atcaccactttgtacatgggtcgtcaatctaagactcctcaaaccgtctacttcgcctct
gaattgaaatgtttgaccgatgactgtgactccatcgttgctttcccaccgggacacgtt
tacgattctaacactgatcaaattactcgttatttcaacccagattggttagacgaagac
agaatcccatccaccccagtcgacttaaaggctatcagagaaacattggaaaaggccgtc
agaaagagattaatggctgaagttccatacggtgtcttattatccggtgggttagattct
tctttaatcgcctccattgccgccagagaaactgaaaaggccatgcaagacgttgacgtg
gaagatgaaaatggtgaacatcacaagcatctaacaggtgtcgatgatgaaggtcattta
cacactggtggatggtctcgtctacattccttcgccattgggttgcctaacgctccagat
ttacaagccgctagaaaggttgccaaattcattggttccgtgcatcatgaacacactttc
actttacaagaaggtttggatgccctagatgatgttatctaccatttggaaacttacgac
gtcactaccattagagcttccactccaatgttcttactttctagaaagattaaggctcaa
ggtgtcaagatggttctttccggtgaaggttccgatgaaattttcggtggttatttgtat
ttcgctcaagctccatctgctgctgaattccacactgaatctgtaaagagagtgaagaac
ttgcatttggctgattgtttgagagctaacaagtctactatggcttggggtctagaggct
cgtgttccattcttagacaaggaattcttgcaattatgtatgaacattgatccaaaggat
aagatgattgaccaagcctctggtaagattgaaaaatacatcttaagaaaggcattcgat
accacagacgatccagaagaaaaaccatacttaccacaagaaatcttatggagacaaaag
gaacaattttcagatggtgttggttactcatggattgatgggttgaaggataccgctgag
agagtcatcagtgatgctatgtttgaaaatccaaaacctcattggggtaacgatgttcca
actactaaggaagcatactggtatagattgaaattcgatgctctttacccacaaaagact
gctgctgataccgttatgagatggattccaaaggctgattggggttgtgctgaagatcca
tctggtagatacgctaagattcatgaaaagcatgttgatggtaactaa

DBGET integrated database retrieval system