KEGG   Naumovozyma castellii: NCAS_0F03680Help
Entry
NCAS_0F03680      CDS       T02233                                 

Gene name
NCAS0F03680
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ncs  Naumovozyma castellii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NCAS_0F03680 (NCAS0F03680)
Exosome [BR:ncs04147]
 Exosomal proteins
  Proteins found in most exosomes
   NCAS_0F03680 (NCAS0F03680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:736311..741275
Genome map
AA seq 1654 aa AA seqDB search
MSDLPIEFTELVDLTSLGISPQSLDFRSTTFESDHYVTVRESHDGSNSVSIVDLANGNQV
TKKNMGGDSAIMHPNQMVISVRANGTIVQIFNLETKTKLKSFTLTEPIIFWKWLNDETLG
LVTSQSVLICNVFDGVVDARPTVLTARHANLNNTQIINFVANAKLDWFAVVGILQENGRI
AGKIQLFSKQRNISQAIDGHVAIFTNILLEGNGSSPVQVFVTGNRNATTGTGELRIIEID
HDQSLPTQYQKKNSEIFFPPDATNDFPIAVQVSEKYGIVYLLTKYGFIHLYELETGTNLF
VNRITAESVFTATSYHEKNGIACINKKGQVLAVEISTSQIVPYILNKLSNVSLALTVATR
GGLPGADDLFTKQFESLLAQNDYQNAAKIAASSQSLRNQNTINRLKNIQAAPGAISPILL
YFSTLLDKGKLNKEETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLSL
ACYLRAQCHPKVISSLAELQQFEKIIPYCQKVNFQPNFLVLISTIARTSPDRASEFAISL
LQNPETAQQLDIEKIADIFFSQNHIQQGTSLLLDALKSDTPDQGHLQTRVLEVNLLHAPQ
VADAIMGNNIFSHYDKPTIASLAEKANLYQRALENYTDITDIKRCIVHTDALPIDWLIAY
FGKLNVEQSLACLRALMDNNLQANIQIIVQVATKYSDLLGSATLIKMFEDYKATEGLYYY
LASLVNLTEDKDVVYKYIEAAAKMNQFTEIERIVRDNNVYDPERVKNFLKDANLNDQIPL
VVVCDRFNFVHELILYLYKSQNLKFIETYVQQINPSRTAQVIGALLDMDCDEKFIQDLLQ
SVLGQVPIAELTTEVEKRNKLKLLLPFLEATLNQGVQDQAVYNALAKIYIDSNNSPEKFL
KENDQYDTLDVGRYCEKRDPYLAYIAYDKGSNDDDLIRITNENTMYKYQARYLLKRSDPE
LWNKVLNPENVHRRQLIDSVISVGIPELTDPEPVSLTVQAFMSNDLKLELIELLEKIILE
PSPFNDNVALQGLLLLSAIKYEPTKVSNYIEKLDNYDADEIAPLCIANDLKEEAFEIYDK
HEMYSKALGVLVEEIMSLDRAATYVDKINTPELWSQLGTAQLDGLRIPDAIDSYIKAEDP
SKFENVIDIAEQAEKYEELIPYLLMARKTLKESKIDGSLILAYAQLDKIHEIENILAGSN
VANLDNVGDKLFELKNYKAARLCYASISNYSKLASTLVYLDDYQGAVDTARKASNIKVWK
LVNDACIEKKEFRLAQICGLNLIIHAEELDELVNKYETNGYFDELISLFEAGMGLERAHM
GMFTELAVLYSKYEPKKTFEHLKLFWSRINIPKVIRAVEDAHLWQELVFLYAHYDEWDNA
ALVMIDKSTKDLDHSYFKEVIVKVSNLEIYYKAINFYVKEHPSLLIDLLSVLTPRLDIPR
TVKIFAKSDNLPLIKPFLINILPKNNSVVNEAYHELVIEEEDYKALQDAVDAYDKFDQLG
LAATLETHDLIFFKKIAALLYRRNKKWAKCLTILKNEKLWKDAIETAAISQDPKVAEDLL
SYFVETGNKEAFVALLYSAYHLIQYDVVLELSWLNSLDDYIKPYEISIKKEQQTNIQKLS
EQLAEKSGEAGANASGQPLMLMNSANTNGFNGGF
NT seq 4965 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctgcctattgaatttacagaattggtcgatttaacctctctagggatttcc
cctcaatccctggactttagatcaaccaccttcgaaagtgaccactatgttaccgtaaga
gaatcccatgatggttccaattcggtgtctatcgtcgatctagccaatggaaatcaagtg
actaagaaaaacatgggtggtgattctgccataatgcatccaaatcaaatggttatctcc
gtgagagctaatggaaccattgtgcaaatcttcaatttggagacaaagacaaaattgaaa
tcgtttaccctaacggaaccaatcattttctggaaatggttaaatgatgaaactttaggt
ttagttacatctcaatcagtcttgatctgcaatgtctttgatggcgttgtagatgccaga
cctaccgtcttgaccgcaagacacgcaaatttgaacaatacccaaattattaactttgtc
gcaaacgctaaactagattggtttgctgtggtgggtatattacaagaaaatggtcgtatt
gccggtaagattcaattattttccaaacaacgtaatatttctcaagcaattgacggacac
gtcgctatcttcacaaacatcttattggaaggtaatggaagtagtcctgttcaagtcttc
gtgacaggtaatagaaacgctactactggaacaggtgaattgagaatcattgaaatcgac
catgatcaatcattgcctactcaatatcaaaagaaaaatagcgaaatttttttcccacct
gatgctactaatgatttcccaattgctgtgcaagtttcagaaaaatatggtattgtttac
ttattgaccaaatatgggttcattcacctatatgaactagaaactggtaccaatctattt
gttaacagaattacagcagaatctgtctttaccgcaacttcatatcatgaaaaaaatggt
attgcctgtattaacaagaagggtcaagttttagcagtggaaatttcaacttctcaaatc
gttccatatatcctaaataagttatcaaatgtttccttagcgctaactgtggcaacaaga
ggtggtcttccaggtgctgatgatttatttacaaagcaatttgaatccttattggcacaa
aacgattaccaaaatgctgccaagattgcagcttcatcacaatcattaagaaaccaaaac
actatcaatagattgaaaaatattcaagctgcaccaggtgccatttctccaatcctatta
tatttctccactttattggataaggggaaattaaataaagaagaaactattgagttagct
agaccagtcttacagcaggacagaaaacaactatttgaaaaatggttgaaagaagataaa
ttggaatgttctgaagaattaggtgacatcgttaagccattcgacaccacattatcattg
gcatgttatttaagagcacaatgtcatccaaaggttatctcatcattggctgaattgcaa
caatttgaaaaaattattccatattgtcaaaaagtgaatttccaaccaaacttcttagtt
ctaatttctaccattgccagaacttctccagatagagcttctgagtttgccatctctttg
ttacaaaatcctgaaaccgcccaacaattggatattgaaaagattgctgatattttcttc
tctcaaaaccatatccaacaaggtacttctctattattagatgctctaaaatctgacact
ccagatcaaggtcatttgcaaacccgtgtcttggaagtcaacttattacatgctccacaa
gtggctgatgctatcatgggtaacaatattttctcccattatgataaaccaactattgcc
tctttagctgaaaaggcaaatttataccagagagctttggagaactataccgatattaca
gatattaagagatgtattgttcatactgatgccttaccaattgactggttaattgcttat
tttggtaaattaaatgtggaacaatctttagcatgtttgagagccttaatggacaacaat
ttgcaagctaatattcaaattatcgtgcaagtggcgactaaatattccgatttattaggt
tctgctaccttgattaagatgttcgaagactataaggccactgaaggtttatactattat
ttggcctccttagtgaacttaactgaagataaggatgttgtttacaaatatattgaagct
gctgccaagatgaatcaattcaccgagattgaaagaattgtcagagataacaatgtctat
gacccagaaagagttaagaacttcttgaaggacgccaacttgaacgaccaaattccattg
gttgttgtttgtgaccgtttcaactttgttcatgaattaattctttatttatacaaatct
caaaatttgaaattcattgaaacttatgtccaacaaattaatccatcaagaactgcccaa
gttattggcgccttattagatatggactgtgatgagaaattcattcaagacttgttacaa
tcagttctaggccaagttccaattgctgagttaactactgaagtggaaaagagaaataaa
ttgaaactattattgcccttcctggaagctactctaaatcaaggtgttcaagaccaagct
gtctacaatgctcttgctaaaatctacatcgattcgaataattctccagagaagttctta
aaagaaaacgaccaatacgatactttagatgttggtcgttactgtgaaaagagagatcca
tacttagcttatatcgcatatgacaaaggttccaatgatgatgatttaatcagaatcacc
aatgaaaacaccatgtacaaataccaagctaggtatttgttaaaacgttctgatccagaa
ttatggaataaagttttgaaccctgaaaatgttcatagacgtcaactgattgattctgtt
atctctgttggtattcctgaattgactgatcctgaaccagtttctttaaccgttcaagct
ttcatgagtaacgatttgaagctggaattaatcgaattgttagaaaagattatcttagaa
ccttctccattcaatgataatgttgctctacaaggactattacttttgtctgcaattaag
tacgaaccaaccaaagtttccaactatattgagaagttagataactacgatgctgatgaa
attgctccattgtgtattgccaacgatttgaaggaagaagcctttgaaatctatgataag
cacgaaatgtacagtaaggccttgggtgtcttggttgaagaaatcatgtctttggataga
gctgctacctacgttgacaaaattaatactccagaattgtggtcccaattgggtactgct
caattagatgggttacgtattccagatgctattgattcttacatcaaggcagaagatcca
tctaagtttgaaaatgttattgacattgctgaacaagctgaaaaatatgaagagttaatc
ccatacttgctgatggcaagaaagaccttgaaggaatccaagattgacggttctttaatt
ttggcctatgctcaactggacaagattcatgaaattgaaaatatcttagccggttcaaat
gttgccaatttggataatgtaggtgataaattgtttgaattgaagaattataaggctgca
agattatgttatgctagtatttccaactattctaaattggcatctactttagtttacttg
gatgattaccaaggagctgttgacactgccagaaaggcttcaaatatcaaggtttggaaa
ttagttaatgatgcttgtattgaaaagaaggagtttagattagcacaaatctgtggtcta
aacttgattattcatgcggaggaattagatgaattggttaataagtatgagaccaatggt
tactttgatgaattaatttctttgtttgaagctggtatgggtcttgaaagagctcatatg
ggtatgtttaccgaattagccgttctttactccaaatatgaaccaaagaagacctttgaa
catttaaaattattctggtcaagaattaatattcctaaggtcatcagagctgtggaagac
gcccatctatggcaagaactggtattcctatatgctcattatgatgaatgggacaatgct
gctttggtcatgatcgataaatctacgaaggatctggatcattcttatttcaaggaggtt
attgtgaaggtttccaatctggaaatttactacaaggctattaacttttatgttaaagaa
catccatctttgttaattgatctgctatctgttttaactccaagattagatattccaaga
actgtaaagatctttgccaaatctgataacttacctctaattaagccattcttaattaac
attctaccaaagaataactctgtggttaacgaagcttatcacgaattagttattgaggaa
gaagattacaaggctctacaagatgctgtcgatgcttatgataagtttgaccaattgggt
cttgctgccacattagaaactcatgatctaatctttttcaagaagattgccgcactgtta
taccgtagaaataagaaatgggccaagtgtttgactatcttgaagaatgagaagctttgg
aaggatgcaattgaaaccgctgcaatttctcaggaccctaaagttgcagaagatttatta
tcgtactttgtggaaactggcaacaaggaagcatttgttgctctgttgtattcagcatac
cacctcatccaatatgacgttgttttagaactttcatggttgaattccttagatgattat
attaagccttatgaaatttccattaagaaggaacaacaaacaaatattcaaaaactttcg
gagcaactagctgaaaaatctggtgaagcaggagcaaatgcctctggtcaacctttgatg
ttaatgaatagcgctaacactaatggtttcaatggtggattttaa

DBGET integrated database retrieval system