KEGG   Naumovozyma castellii: NCAS_0G02510Help
Entry
NCAS_0G02510      CDS       T02233                                 

Gene name
NCAS0G02510
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ncs  Naumovozyma castellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ncs01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncs00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ncs00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:449563..451227
Genome map
AA seq 554 aa AA seqDB search
MVKVSLDNVQLLVDIDKQPAFPPSQTTVATILSKEALEFIVLLHRTFNERRKALLANRQQ
VQARLDSGNYQLDFLPETANIRSDPVWQGPTLAPGLINRGCEITGPPLRNMLINALNSDV
NTYMTDFEDSMSPTWNNVIYGQVNLFDAVRDQINFKTPRKEYKLNDKFENLPTVIVRPRG
WHLLEKHLIVDNEPISASIFDFGLFFYNNANKLVSLGKGPYFYLPKMEHHLEAKLWNDIF
NVAQDYIGMTRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN
LPQHVLPNRDQVTMTSPFMNAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPKANETAMNK
VRTDKIRELTNGHDGSWIAHPALAAICNEVFINMGTANQIHYVPDCNITAGNLVETNIVG
GQVTIEGIKQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLYQWVHHGVVLSD
TGEKVTPQLTEQLLNEQVAKLSKASPLGNKNKYATAAKYFLPEIKGEKCSEFLTTLLYDE
IVTKKSRPTDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagtatccctggacaacgtgcaactgctagtcgacatcgacaaacaacctgct
ttcccaccttcgcaaacaaccgtcgctaccatcctctccaaagaggcactcgaattcatc
gttctcttgcatcgcactttcaatgaaagacgcaaggccttgctagccaacagacaacaa
gtacaggcaagattggattccggcaactaccaactggatttccttcctgaaacggcaaac
attagaagcgatcccgtgtggcagggccccactttggctcccggcttgatcaatagaggt
tgtgagattacaggcccacctttaagaaacatgttgatcaacgcactaaactcagatgtc
aatacttatatgaccgattttgaagactccatgtcccccacttggaataacgtcatttac
ggtcaggttaacttgttcgatgccgtgagagatcaaattaatttcaagacgccaagaaag
gaatataaattgaatgataaattcgaaaatttaccaactgtcattgtgagacctcgtgga
tggcatctactggaaaagcatttgattgtggataatgaacccatctctgcatccatcttc
gatttcggtctgttcttttacaataacgctaacaaattagtttctctgggaaaaggtcct
tacttttacttgcccaagatggaacatcatttggaagccaaattatggaatgatatcttt
aacgtcgcacaggattacatcggaatgacacgtggtaccattagagccacagtccttatt
gaaactttacccgctgctttccaaatggaggaaatcatttatcaattgagacagcattca
agtgggttgaattgtggtcgttgggattacatattctctacaattaaaagattaagaaat
ttaccacaacatgtattaccaaatagagatcaagtgacaatgacctcccccttcatgaac
gcatacgtgaaacgtttaattaacacgtgtcatcgtcgtggtgtccatgcaatgggtggt
atggccgctcaaatccccatcaaggatgacccaaaggctaatgaaacagcaatgaataaa
gtgagaactgacaagattagagaattgactaatggtcatgatggctcttggatcgcacac
cctgcattggctgccatttgtaatgaagttttcatcaatatggggacagcaaatcaaatt
cattacgtaccagattgtaacatcactgctggaaatttggtagagacaaatatcgtcggg
ggacaagtcaccatcgagggtatcaaacaaaatttggacattgggttgcaatacatggaa
gcctggttgagaggttcaggttgtgtccccattaataacttgatggaagatgctgctact
gctgaagtgtctcgttgtcaattgtatcaatgggttcatcatggtgtggttctcagtgac
acgggtgaaaaagtaactccacaattaactgaacagttgttgaatgaacaagtggcaaaa
ttatccaaggcaagtccattggggaacaagaacaaatacgctactgctgctaaatacttc
ttgcccgaaatcaaaggtgaaaagtgtagtgaattcttaaccactttattgtacgatgaa
atcgtaaccaaaaaatcccgtccaacagacttgagcaagttgtga

DBGET integrated database retrieval system