KEGG   Naumovozyma castellii: NCAS_0G02900Help
Entry
NCAS_0G02900      CDS       T02233                                 

Gene name
NCAS0G02900
Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ncs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ncs00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ncs00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncs00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:530899..532338
Genome map
AA seq 479 aa AA seqDB search
MSALLRAIPRFSSTSLRSQLRTQLRLQLTASYASYPAHTIIGMPSLSPTMTHGNLVAWSK
QVGDQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPEGTKDVPINKPIAVYVEDADDV
AAFKDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQPTQKSKEQKSSPVTQEDTTGR
IIASPLAKKIALENGVALKGFKGSGPHGRIVKDDVLKLVEQQKKAATATAASPKGPSSTS
GTGISSYEDVEISNMRKIIGDRLLQSTQGIPSYIISSDISVSKLLKLRKSLNSTAKDKYK
LSINDILIKAVTVAAKRVPDANAYWRPDGQDIIRKFKNVDVSVAVATPTGLLTPIVKNAD
SKGLVTISNEVKELVKRAKINKLAPEEFQGGTICISNMGMNDSISMFTSIINPPQSTILA
IGTVKKVAVEDAGAESGFCFDEQMTITGTFDHRTIDGAKGADFMKELKTVIENPLELLL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccctcctaagagccattccaagattttcgagcacctccctaagatctcaacta
cgcacgcaattaagattgcaattgaccgcttcatatgcctcgtatcccgcacataccata
ataggtatgccatccctatctcccactatgacacatggtaacttggttgcatggtccaag
caggtgggagatcaattggctccaggggacgtccttgcggaactggaaactgataaggct
caaatggatttcgaattccaagatgatggatatttagccaagatcttggtccccgaggga
accaaagatgttccaattaataaaccaatcgcagtttacgtggaggatgcagacgatgtg
gccgcctttaaagattttaaaattgaagattcagcagatgcagcagctactactactact
acggaagtgaaagaggaaaagccacaacaacctgaaaagattaacgctcaacagcaacca
actcaaaaatcaaaagaacagaaatcatcgccagtcactcaagaagatactactggaaga
attattgcttcacctttggcaaagaaaatagctttggagaatggtgtagctttaaagggt
ttcaagggttctggtccacatggaagaattgttaaagatgacgttctaaagttagtggaa
caacaaaagaaagctgcaaccgccacagcagcttcaccaaagggaccttcctcaacttcg
ggtactggtatttcctcgtatgaagatgttgaaatttccaatatgagaaaaattattggt
gatcgtttgctacaatctacgcagggtatcccatcttacattatttcttctgatatttca
gtatcgaaactactaaaattaagaaaatctttgaattcaacagccaaggacaaatataag
ttatccataaatgatatcttaattaaagctgtcactgttgccgccaagagagttccagat
gccaatgcctattggagaccagatggacaagatattattaggaaattcaagaatgtggat
gtttcagtagcagtcgctacaccaacaggtttactaaccccaattgtgaaaaatgccgac
tctaagggtttagtgacaatttctaatgaagtgaaggaattagtgaaacgtgcaaagata
aataaattggctcctgaagaatttcaaggtggtaccatctgcatatctaatatgggtatg
aacgattctatttctatgtttacctcgatcattaatccacctcaatccactatcctagct
attgggaccgttaaaaaagttgctgtagaagatgccggtgctgaaagtggattctgtttt
gacgaacaaatgacaataacaggaacatttgatcatagaaccatcgacggtgcaaaaggt
gcagattttatgaaggaattgaagactgtcattgaaaatcctctggaattattattgtga

DBGET integrated database retrieval system