KEGG   Naumovozyma castellii: NCAS_0G02900Help
Entry
NCAS_0G02900      CDS       T02233                                 

Gene name
NCAS0G02900
Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00020  Citrate cycle (TCA cycle)
ncs00620  Pyruvate metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0G02900 (NCAS0G02900)
   00020 Citrate cycle (TCA cycle)
    NCAS_0G02900 (NCAS0G02900)
   00620 Pyruvate metabolism
    NCAS_0G02900 (NCAS0G02900)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NCAS_0G02900 (NCAS0G02900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3614
Motif
Other DBs
NCBI-GeneID: 11528448
NCBI-ProteinID: XP_003677529
UniProt: G0VIE2
Position
7:530899..532338
Genome map
AA seq 479 aa AA seqDB search
MSALLRAIPRFSSTSLRSQLRTQLRLQLTASYASYPAHTIIGMPSLSPTMTHGNLVAWSK
QVGDQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPEGTKDVPINKPIAVYVEDADDV
AAFKDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQPTQKSKEQKSSPVTQEDTTGR
IIASPLAKKIALENGVALKGFKGSGPHGRIVKDDVLKLVEQQKKAATATAASPKGPSSTS
GTGISSYEDVEISNMRKIIGDRLLQSTQGIPSYIISSDISVSKLLKLRKSLNSTAKDKYK
LSINDILIKAVTVAAKRVPDANAYWRPDGQDIIRKFKNVDVSVAVATPTGLLTPIVKNAD
SKGLVTISNEVKELVKRAKINKLAPEEFQGGTICISNMGMNDSISMFTSIINPPQSTILA
IGTVKKVAVEDAGAESGFCFDEQMTITGTFDHRTIDGAKGADFMKELKTVIENPLELLL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccctcctaagagccattccaagattttcgagcacctccctaagatctcaacta
cgcacgcaattaagattgcaattgaccgcttcatatgcctcgtatcccgcacataccata
ataggtatgccatccctatctcccactatgacacatggtaacttggttgcatggtccaag
caggtgggagatcaattggctccaggggacgtccttgcggaactggaaactgataaggct
caaatggatttcgaattccaagatgatggatatttagccaagatcttggtccccgaggga
accaaagatgttccaattaataaaccaatcgcagtttacgtggaggatgcagacgatgtg
gccgcctttaaagattttaaaattgaagattcagcagatgcagcagctactactactact
acggaagtgaaagaggaaaagccacaacaacctgaaaagattaacgctcaacagcaacca
actcaaaaatcaaaagaacagaaatcatcgccagtcactcaagaagatactactggaaga
attattgcttcacctttggcaaagaaaatagctttggagaatggtgtagctttaaagggt
ttcaagggttctggtccacatggaagaattgttaaagatgacgttctaaagttagtggaa
caacaaaagaaagctgcaaccgccacagcagcttcaccaaagggaccttcctcaacttcg
ggtactggtatttcctcgtatgaagatgttgaaatttccaatatgagaaaaattattggt
gatcgtttgctacaatctacgcagggtatcccatcttacattatttcttctgatatttca
gtatcgaaactactaaaattaagaaaatctttgaattcaacagccaaggacaaatataag
ttatccataaatgatatcttaattaaagctgtcactgttgccgccaagagagttccagat
gccaatgcctattggagaccagatggacaagatattattaggaaattcaagaatgtggat
gtttcagtagcagtcgctacaccaacaggtttactaaccccaattgtgaaaaatgccgac
tctaagggtttagtgacaatttctaatgaagtgaaggaattagtgaaacgtgcaaagata
aataaattggctcctgaagaatttcaaggtggtaccatctgcatatctaatatgggtatg
aacgattctatttctatgtttacctcgatcattaatccacctcaatccactatcctagct
attgggaccgttaaaaaagttgctgtagaagatgccggtgctgaaagtggattctgtttt
gacgaacaaatgacaataacaggaacatttgatcatagaaccatcgacggtgcaaaaggt
gcagattttatgaaggaattgaagactgtcattgaaaatcctctggaattattattgtga

DBGET integrated database retrieval system