KEGG   Naumovozyma castellii: NCAS_0G03140Help
Entry
NCAS_0G03140      CDS       T02233                                 

Gene name
NCAS0G03140
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ncs  Naumovozyma castellii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0G03140 (NCAS0G03140)
Enzymes [BR:ncs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NCAS_0G03140 (NCAS0G03140)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCAS_0G03140 (NCAS0G03140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:576838..578952
Genome map
AA seq 704 aa AA seqDB search
MSQEIPANVKEAVEFDPWLKPFAQVLSERRYLADKWVYDITHATPDGSYQSLAKFTRDSI
KNYGLHANKQTKEIYYKEWAPNAKRAFLVGEFNNWDGTNHELKNKDEFGNFSITIPPLAD
GSFAIPHDSKIKVKFQLEDGSEIYRLPAWITRATQPTKETAKQFGPTYEGRFWNPDNEYH
FQHQRPKFNQKTDSLRIYEAHVGISSPEPKVTSYKEFTQNVLPRIQKLGYDAIQLMAIME
HAYYASFGYQVTNFFAASSRYGTPEDLKELIDTAHGMGILVLLDVVHSHASKNVEDGLNN
FDGSDHQYFHSISSGRGEHPLWDSRLFNYGSFEVQRFLLSNLTYYIDTYKFDGFRFDGVT
SMLYMHHGVGAGGAFSGDYNEYLSKERSAVDHEALAYLMIANDLVHELLPESAVTIAEDV
SGYPTLCLPRHMGGGGFDYRLAMALPDMWIKILKTKTDEQWDLANIVFTLTNRRYGEKVV
AYCESHDQALVGDKTLAFWLMDAEMYTGMSTLQEPSLVIDRGIALHKLIRLLTHALGGEA
YLNFEGNEFGHPEWLDFPNVNNGDSYHYARRQFNLVDDHLLRYQHLNNFDSAMQHCEKNH
QWLNTPQAYVSLKNESDKVIAFERNGLLFIFNLHPNNSYTDYRVGIEQAGTYRIVLNSDR
PEFGGHNRIDENGRFQTTDLEWNNRKNFLQVYIPSRTAIVLALE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggaaatcccagcaaacgttaaggaagcagtcgagttcgacccttggttgaaa
ccattcgctcaagtcctctcagagagacgttacctcgcagacaaatgggtctacgacatc
acgcacgctactcccgatggctcgtatcagtccctggccaagtttactagggattccatt
aagaactacggtcttcacgctaataagcaaacaaaggaaatttactacaaggaatgggct
cctaatgccaaacgtgcattcttagtaggggaattcaacaattgggacggtaccaaccat
gaattgaaaaacaaggacgagttcggtaacttctccatcacaattccaccattggctgat
ggttcattcgctatccctcacgactccaagattaaagtcaaattccaactggaagatggt
tctgaaatttaccgtctacctgcatggattacaagagctacacaaccaacaaaggaaacg
gcaaagcaattcggccccacttatgagggtagattttggaatccagataatgaataccat
ttccaacatcaaagacctaaattcaaccaaaagactgattctctaagaatttacgaagct
catgtcgggatctcttctccagaaccaaaagtaacctcttacaaagagtttactcaaaat
gtcttaccaagaattcaaaaattaggttacgatgccattcaattaatggctataatggaa
catgcatactatgcctctttcggttatcaagtaacaaacttctttgcagcaagttctcgt
tatgggacaccagaagatttgaaagaattaattgataccgctcatggaatgggtatcttg
gttctattggatgtcgttcatagtcatgcatccaagaatgtcgaagatgggttaaacaat
ttcgatgggtccgatcatcaatatttccattccatctcttcaggaagaggtgaacatcca
ttatgggattcacgtttgtttaattacggaagcttcgaagttcaaagattcttattatcc
aatttgacttactatattgacacctataaatttgacgggttcagattcgatggggtcact
tcaatgctttatatgcatcatggtgtaggtgccggaggtgccttcagtggtgattataat
gaatatttatctaaggaaagatctgctgtggatcatgaagctttagcatacttgatgatt
gctaatgatttggttcatgaattattaccagaatccgctgttaccatcgctgaagatgtt
tcaggttatccaactttatgtttaccacgtcacatgggtggtggtgggttcgattataga
ttggccatggctttacctgatatgtggattaagattttgaaaacaaagacagatgaacaa
tgggatttagcaaatattgtctttactttgactaatagacgttatggtgaaaaggttgtc
gcatactgtgaatctcatgatcaagctctagttggtgataagactttagcattttggtta
atggatgcagaaatgtatacaggaatgagtacattacaagaaccttctttagtcattgat
cgtggtatcgcattacataaattgattagattgttgactcatgctcttggtggtgaagct
tacttgaattttgaagggaatgaattcggtcatccagaatggttagatttccctaacgtt
aataatggagacagttaccattatgctcgtagacaattcaatttggtcgatgatcattta
ttgcgttatcaacatttgaacaatttcgactcagcaatgcaacattgtgaaaaaaatcat
caatggttgaacactccacaagcttatgtctctttgaaaaatgaaagtgataaagtcatt
gcttttgaacgtaatggactcttgttcatctttaacttgcacccaaataatagttacaca
gactacagagtcggtatcgaacaagctggtacttatcgtatcgtattaaactctgataga
cccgaatttggcggtcataatagaattgacgaaaatgggagattccaaacaactgattta
gaatggaataacagaaagaacttccttcaagtttatatcccaagtagaactgccattgtc
ttagccctggaatag

DBGET integrated database retrieval system