KEGG   Naumovozyma castellii: NCAS_0G03440Help
Entry
NCAS_0G03440      CDS       T02233                                 

Gene name
NCAS0G03440
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ncs  Naumovozyma castellii
Brite
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   NCAS_0G03440 (NCAS0G03440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:634813..642192
Genome map
AA seq 2459 aa AA seqDB search
MLSLRKRVEAKSQERKKLSSKSHSENDLSSQSATAVTVGTDPRRVALQSGTDANGFSEND
YTVNALDTSLSQFTLIFEKIKSPISQERLAAANELNTSLTSLTREVSVEEFQRFSNSLNN
KIFELIHSSDPNEKIGGILAVDTLINFYSHTEELPNQTSRLANYLRVLIPSSDIDVMRLA
ANTIGKLAIPGGTLTSDFIDSEVKIALEWLTTSPDNIASSSKQEYSKHAALLLISALADN
SPYLLYPYVNSILDNIWRALRDTKLVIRMDAALILGKCLTIIQNRDPSLTKQWFLKLFKG
CARGLNLNTNEAIHATLLVYRELLTLKGSYLNGKFSEIYRSTIKYKDHKYDVIRKEVYAI
LPLLASFNTELFTKSYLDQVMVHYLGILKNTNSSAANTADKPAILVSIGDISSEVGSSIA
PYVIPILDNVRDGLQTKYKHRKAFERELFYCIGKLTIAMGPALAKHINKGLLDQILSCSL
SDYMQNTLLIIIERIPALEPTINLRLLDLLCMYLSGEKYSHPGSPTSLKPLSMEKARLWR
NKVVMVKTGEINDDVKDAQLLSQALKMLQNINYKYSLTEFVRLITISYIEHENFHVRKLA
ALTSCDIFAKDTICKQTSFHALNSVSEVLSKLLTVAITDPIPDIRLEILQHLVPAFNSQL
GQPDNLRLLFMAANDEMFAIEIEAVQIIGRLTTINPAYVVPSLRKTLLELLTQLKYSTMP
RKKEESATMLYTLIHFGKDVTKPYIEPILDILLPKANDTSSAVASTALKAIGELAAVSGE
DIKKYLPDLMPLIITTFQDQSNSFKRSAALKALGQLAVSAGYVIDPLLDYPELLGVLLNI
LKSESSQNIRRETVHLLGTLGALDPYKHREVEVASNSQNSVEQNAPPIDIALLMQGMSPS
NEEYYPTVVINTLLKILHDPSLSSHHTAVIQAIMNIFQSLGLRCVSFLKQIVPGIISVMR
SCTPSLLEFYFQQLGLLVSIVKQHIKPHVDEIYEVIKDFFPIIKLQITIISLIEAMSKSI
DSEFKKFVPVTLTFFLPVLENDKSNKKIVSIRILKSLVAFGSNLEDFTHLIIPTVVRISE
YSPGNLGKIAVIALGKLAKNINLSEMSSRIIQTLIRLLNRGEADLTRTTMNTVCLFLLQL
GSDFIVFIPVLNKTLMKNHIQHSIYDQLVNKLLNNEGLPTNIVFDKDFDVPSKPINDVET
ALKKLPVNQTLLKNTWDCSQQRTKEDWQEWIRRLSIQLLRESPSPALRACSNLVGIYYPL
AKDLFNASFSSCWSELYSQYQEDLIQSLCTALRSPQNPPEIFQILLNLVEFMEHDDKPLP
IPVETLGKYAQKCHAFAKALHYKELEFLQEPSTSTIEALISINNQLHQTDAAIGILKHAQ
QHHDLQLKETWYEKLQRWDDALEAYTEREKAGEDTIEVTMGKMRSLHALGEWVQLSELAE
EKWEISKPNVQKLMAPLAAGAAWGLGQWDKIELYTNVMKVQSPDKEFFDAILCLHRNNFK
KGEEHIFSARDLLVTELSALVNESYNRAYNVVVRTQIISELEEIIGYKKLPQHSEKRILM
REMWNKRLLGCQKNVDVWQRVLRVRSLVVEPKQDVQIWIKFANLCRKSGRLGLAKKALTS
LFEDGGNPNHPNIAKALPPVVYAQLKYIWATGSQSEALQQLIKFTSRMAHDLGLDPRNMI
SQSSPQNSKIAPEDVKEYTKLLARCFLKQGEWRVVLQPEWRLKNPDAILGSYLLATHFDD
TWYKAWHNWALANFEVISMITSGPKGNTTATNMPLNGADQFKNGMIGANTFDTEENNYPA
TMIHRHVVPAIKGFFHSIALSESSSLQDALRLLTLWFTFGGIPEATQAMHEGFNMIKIGT
WLEVLPQLISRIHQPNQIVSRSLLSLLSDLGKAHPQALVYPLTVAIKSESVSRQKAALSI
IEKMRMHSPILVDQAELVSTELIRVAVLWHELWYEGLEDASRQFFGEHNTEKMLASLEPL
HALLNHGPETIREISFQNAFGRDLKNAYEWVLNYKRTNDTSNLNQAWDIYYNVFRRISKQ
LPQLQTLELQHVSPKLYATHDLQLALPGTYYPNKRIVKISSFSSVFTVISSKQRPRKLTI
NGDDGKEYQYILKGHEDIRQDSLVMQLFGLVNTLLQNDAECFRRHLDIQQYPAIPLSPKS
GILGWVPNSDTFHVLIKEYREARKIPLNIEHWVILQMAPDFDTLTFLQKIEVFTYALNNT
QGQDLYKVLWFKSRSSESWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLDRLTGKVI
HIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKESL
MAILEAFAFDPLIHWGFDLPTEKIAEQTGIDLPLANPNELLRKNMISAEEAARMEIEQSN
AIRNARAMLVLRRITDKLTGNDIGRFKELDVPKQVEKLIQQATSVENLCQHYIGWCPFW
NT seq 7380 nt NT seq  +upstreamnt  +downstreamnt
atgctctctttaagaaaaagggtggaagcaaaaagccaagaaagaaagaagctatcttct
aaatcacattccgaaaatgatctatcgtcacaatctgcaacagcagttactgtcggcaca
gatccccggagagtggcattgcagtcaggaacagatgcaaatggcttttcagaaaatgat
tatacggtcaacgctttagatacaagcctttctcagtttactttaatcttcgagaaaata
aagagccctatatcccaggagagactagcggcagcaaatgaattgaatacctccttaact
tcattaacgagggaagtatctgttgaagaatttcaacgatttagtaacagtttaaataac
aagatttttgaacttatccatagctcagatccgaatgaaaagataggtggtatcctagct
gtagatacacttatcaatttctattcacatacagaggaattaccaaatcaaacatccaga
ttagcaaattacttgcgagttctaataccttcgagcgatattgatgtgatgcgacttgcc
gcaaacaccataggaaagttggcaatacctggaggaacactcacgtcagacttcattgat
tcagaggttaaaattgctcttgaatggttaacaacatcaccggacaacatagcttccagc
tctaaacaagaatacagtaagcatgcggcattacttttgatatctgcactggctgataat
tctccatatttattatacccatacgtcaattcaatccttgacaatatatggagagcatta
agagatactaaactggttatacgaatggatgctgccctgatattaggtaaatgtcttacc
attatacaaaacagagatccgtcattaacaaaacaatggtttttgaagttatttaaaggc
tgcgcaagaggattgaatcttaatactaatgaagccatacatgctacattgctagtatac
agggaactattaacattgaaaggttcatacttaaatggaaagttcagtgaaatatatcgg
tcgacaatcaaatataaagaccacaagtatgacgttattagaaaagaagtatatgcaata
ttacccctactggcatcgtttaataccgaactatttaccaaatcatatcttgatcaagtt
atggttcattatcttggaatcctaaaaaatacaaattccagtgcggcaaatactgcagat
aaacccgccattttggtttccattggagatatatcatctgaagtcggctcaagtattgcc
ccatatgtaatacccatactggacaatgttagagatggattacagacaaaatacaaacac
aggaaagcttttgaaagggaattattctattgcatcggaaaattgaccattgcaatgggg
cctgctctagcaaaacacataaataaagggcttttggatcaaattttgtcctgttccctt
tctgattatatgcaaaacaccctattaatcataatagaaagaataccagcacttgagccc
accatcaacttaagactgttagatctactgtgtatgtacctttcaggggagaaatatagt
catcctggatcaccaacgtcattgaaacctctttctatggagaaagctcgattatggagg
aataaagtagtcatggtgaaaacaggagaaattaatgatgacgttaaagatgctcagttg
ttgtcacaggcacttaaaatgctccaaaatataaattataaatattcgttgaccgaattt
gttcggcttataacaatttcatacatcgaacatgagaacttccatgttcgaaaattagct
gctttgacatcgtgcgacatcttcgccaaagatactatttgcaaacaaacctctttccat
gcactgaattctgtttctgaggtactcagtaaattactaacagttgccataacggatccc
atacctgacatacgattagaaattttacaacatctggtacccgcctttaattcacagctg
gggcaacctgataatctgaggttactttttatggccgcaaacgacgaaatgtttgcaatt
gaaatagaagctgtgcaaataattggtagacttacgaccatcaatccagcttatgtagtg
ccttcgttgagaaaaacattactagaattactgacacaattgaagtactcaactatgcca
aggaagaaagaagagagtgcaaccatgttatataccttaatccattttgggaaagacgta
accaaaccatacattgagcctatcctcgatattttacttcctaaagcaaatgacacatcc
tcagcagtagcgtcgacagcattgaaagctatcggagaactcgctgctgttagtggcgag
gacataaaaaaatacttgcctgatctcatgcctttgatcattactacttttcaagatcaa
tccaattcattcaaaaggagtgcagctttgaaagccttaggtcagttggcagtatctgca
ggatatgtaatagatccattattagattatccagaacttctaggtgttttgttgaatatt
ctgaaatctgaaagtagtcaaaatattcgtcgggagactgttcatttactaggtactttg
ggtgcactagacccgtacaaacacagagaagtagaggttgcatcaaattctcagaattct
gtcgaacaaaatgcgcctcccattgatatagcgctactcatgcagggaatgtcaccctca
aatgaggaatattatccaacagttgtgataaatacattactgaaaattctccatgatcca
tctctttcttctcatcatacagcggttattcaagctattatgaacatattccaaagcctg
ggactacgttgcgtttcatttttaaaacagatagtgccaggcataatttcagttatgcgt
tcatgcacaccttctttactggaattttattttcaacaattgggccttttggtgtctatt
gttaagcagcacatcaaaccgcatgttgatgaaatatatgaagttatcaaagatttcttt
cctatcataaagctacagataacgattatttctcttattgaagctatgtctaagtctatc
gatagtgaattcaaaaagtttgttcctgtaacgcttaccttctttttaccagtgcttgaa
aacgataaatccaacaaaaagattgtttctataagaattttgaagtccttggtggcattt
ggttctaatcttgaagattttactcatttgatcataccgacagtcgtaaggatatcagaa
tactctcctggaaatttgggaaaaattgcagtaattgcactgggaaaactagccaagaac
attaacctctctgaaatgtcttcaagaatcatccaaacattgataagattgctgaataga
ggtgaagccgatttgacaaggacaacaatgaacacagtgtgcctatttttacttcaactg
ggtagtgactttattgtctttattccagtgctaaacaagaccttaatgaagaatcatatt
caacattcaatttacgaccaacttgttaataaactgttaaataatgaaggattaccaact
aatattgtttttgataaagatttcgatgtcccctcaaaaccaattaatgatgttgaaact
gctcttaaaaagttacctgtaaaccaaactcttttgaaaaacacgtgggactgtagtcaa
cagcggactaaggaagattggcaggaatggatcagaaggctatccatccaactcttacga
gaatcaccttcacctgcacttagggcatgctctaatttggtaggtatctattatccattg
gcaaaagatttatttaacgcttcgttctcgagctgctggagtgagttatatagccaatac
caagaagatttgatacaatcactttgtactgcgttgcgatcgccccaaaatccgccagaa
attttccaaatattattaaacttagtggaatttatggaacatgacgataagccattgcca
attccggttgaaacattagggaagtatgcacaaaaatgccatgcatttgccaaggcattg
cactacaaagaattggaatttttacaggaaccatcaacttcaactattgaggcgttaatc
agtataaataatcaacttcaccaaactgatgctgctattggaattttgaaacatgcgcaa
caacatcacgatctgcaattgaaggaaacttggtatgaaaagcttcaaagatgggatgat
gctctggaagcatacacagagcgtgaaaaagctggagaggatacaattgaagtgacaatg
ggtaaaatgagatcactgcacgcccttggagagtgggttcaactttctgagcttgcagaa
gagaaatgggaaatttcaaaaccaaacgtccagaaactaatggcaccattagcagcagga
gcagcgtggggtctaggacagtgggataaaattgagctctacactaatgtcatgaaagtt
caatctcctgataaggaattctttgatgctatactgtgtctacatagaaataatttcaag
aaaggagaggaacatatatttagtgcgagggatctgcttgtgacggaactttctgcccta
gtcaatgaaagttacaatcgagcatacaatgtagtagtaagaacccaaataatttctgaa
ctagaagaaattattggctataagaagcttcctcaacattcagaaaaaagaatattaatg
agagagatgtggaataagagactacttggttgccagaagaatgttgatgtctggcaaaga
gtattaagagtcagatctttagttgttgaaccaaagcaagatgtacagatatggattaag
tttgctaatctttgcagaaaatcaggtagattaggtttggcaaagaaagccttaacgtca
ttattcgaagacggtggaaatccaaatcatcctaatattgcaaaggcgctacctcccgtt
gtttatgcccaacttaaatacatatgggcaactggctctcaatctgaggctttgcaacag
cttataaagtttacatcacgtatggctcatgatcttggattggatcctcgtaatatgata
tcccagagctctccacaaaatagtaagatagcacctgaggatgttaaagaatacactaag
ctattggctcgttgctttctaaaacaaggtgaatggcgagttgttctccagccagaatgg
agacttaaaaatccggatgctattctagggtcgtatctattagctactcacttcgatgat
acgtggtacaaagcttggcataattgggcgttagcaaactttgaggttatttctatgata
acatcaggcccaaaaggaaatacaacagccacaaatatgcccttaaatggcgctgatcaa
ttcaaaaacggtatgataggtgcgaatacatttgatactgaagagaacaattatcctgca
acaatgattcatagacatgtagttccagctataaaggggtttttccattcgatagcactt
tcggaatctagttcccttcaggatgcactgagattactgacactatggtttacatttggt
ggaatacccgaagctactcaagccatgcacgaaggatttaatatgattaaaatcggcaca
tggcttgaagtacttcctcagctaatctctcgtattcaccaacctaaccaaatagttagt
aggtcgttgctttctttattgtcggatctgggaaaggctcatccacaggcacttgtctac
cccttgacagtcgctataaagtctgaatcagtatcacgccaaaaagctgccctctctatt
atagaaaaaatgagaatgcacagccctattcttgttgatcaagccgaactagttagtaca
gaactaatccgtgtagccgtcctatggcatgaactatggtatgaaggtttagaagatgca
agtagacagttttttggagaacataataccgagaaaatgctggcatccttagaacctctt
catgcattgttaaaccacgggcccgagacaatacgtgagatctccttccaaaatgcattt
ggaagggatctaaaaaatgcatatgaatgggtactgaattataagcgcactaatgacact
agtaatctgaatcaagcctgggatatttactataatgtattcagaaggattagtaaacaa
ctacctcagttacaaacactcgaattgcaacatgtttcccccaaactgtacgcaacccat
gacttacaactagctctaccaggcacatactaccctaataaaagaatcgttaaaatttcg
tcattttcatcagttttcaccgtgatctcttctaaacaaagacctcgtaaactaacaatt
aatggtgatgatgggaaagagtaccagtacattttaaagggtcatgaagacattagacaa
gatagcttggtcatgcaactctttggtttggtaaacactttactacaaaatgatgccgaa
tgcttccgtcgtcatttagatatccagcaatacccagcaatcccattatcacctaaatca
ggtattttaggttgggttcccaacagcgataccttccatgttctgattaaagagtatcgt
gaagctaggaaaattccactcaatattgaacattgggtcatcttacaaatggctccagat
tttgatacattaacctttttacaaaagatagaggtttttacatatgctctcaataacaca
caagggcaagatctttacaaagttctatggttcaaaagtagatcatcagaatcgtggtta
gaacgccgaacaacttacacaagatcattagcggtcatgtcaatgactggttatattctc
ggattaggtgatcgtcacccaagtaatttgatgcttgatagacttacaggtaaggtaatt
catatcgattttggagactgtttcgaagctgcaatcctaagagagaagttccccgaaaag
gtaccatttagattaacgagaatgttaacttacgccatggaagttagtggaattgaaggg
agtttcagaataacatgtgaaaacgttatgagagttttgagagacaataaggaatcattg
atggcaatcttagaagcctttgcattcgatcctttaattcattggggttttgatcttccc
acggaaaaaatagctgaacagacaggtatcgatcttcctttagctaatcctaacgagctt
ttgagaaagaatatgatttccgccgaagaagctgcacgtatggaaatagaacaaagtaat
gctattagaaatgcaagggcaatgttggtattaagacgaattacagataaattaactggt
aacgatattggacgcttcaaggaactagatgtaccaaagcaagttgaaaaactaattcaa
caagcaacttcagtagaaaacctttgtcaacattacattggttggtgccctttctggtaa

DBGET integrated database retrieval system