KEGG   Naumovozyma castellii: NCAS_0G04140Help
Entry
NCAS_0G04140      CDS       T02233                                 

Gene name
NCAS0G04140
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ncs  Naumovozyma castellii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NCAS_0G04140 (NCAS0G04140)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:771168..771515
Genome map
AA seq 115 aa AA seqDB search
MPPKKESSEYKPGNEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGVFGRHSGKAPGYSY
TDANVKKDVEWNEQNMSDYLTNPKKYIPGTKMAFGGLKKDKDRNDLITYLKKATD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaaagaaagaaagcagtgaatataaaccaggtaatgaaaagaaaggtgccacc
cttttcaaaaccagatgtctacaatgtcataccgtagaggaaggtggtcctcataaagtg
ggtcccaacttacatggtgtattcggtcgtcactctgggaaagctccaggttactcctac
actgatgctaacgtgaaaaaggatgtagagtggaatgaacagaatatgtctgattattta
acaaacccaaagaaatatatcccaggcactaagatggcgtttggtggattaaagaaggat
aaggatagaaacgatttgattacttatttgaagaaggccactgattag

DBGET integrated database retrieval system