KEGG   Naumovozyma castellii: NCAS_0G04140Help
Entry
NCAS_0G04140      CDS       T02233                                 

Gene name
NCAS0G04140
Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ncs  Naumovozyma castellii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 11528731
NCBI-ProteinID: XP_003677652
UniProt: G0VHJ4
Position
7:771168..771515
Genome map
AA seq 115 aa AA seqDB search
MPPKKESSEYKPGNEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGVFGRHSGKAPGYSY
TDANVKKDVEWNEQNMSDYLTNPKKYIPGTKMAFGGLKKDKDRNDLITYLKKATD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcccccaaagaaagaaagcagtgaatataaaccaggtaatgaaaagaaaggtgccacc
cttttcaaaaccagatgtctacaatgtcataccgtagaggaaggtggtcctcataaagtg
ggtcccaacttacatggtgtattcggtcgtcactctgggaaagctccaggttactcctac
actgatgctaacgtgaaaaaggatgtagagtggaatgaacagaatatgtctgattattta
acaaacccaaagaaatatatcccaggcactaagatggcgtttggtggattaaagaaggat
aaggatagaaacgatttgattacttatttgaagaaggccactgattag

DBGET integrated database retrieval system