KEGG   Naumovozyma castellii: NCAS_0H00530Help
Entry
NCAS_0H00530      CDS       T02233                                 

Gene name
NCAS0H00530
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(90088..90804)
Genome map
AA seq 238 aa AA seqDB search
MSDNKTRAVVPLESNPEVFTEFAHKLGLQSGFAFHDIYSLTDADLLEFLPRPVKAIILLF
PLNEFFETHKPQSPNRGVQKGGADNTIWFKQNIKNACGLYAILHSLSNNKSLLEDDSTLS
KFLQTYDKKNVDATDEFIYNVSETFSDNFEAGQTSAPDPNDDVNLHFITFVADPESKDVY
ELDGRNENGPIFIGKLDESVDNGDLIGQKDLIARVQWYMNNASEADKLNFSLLGLSWN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacaagacaagagcagtagtacccctggagtccaatccagaagtgttcacg
gagtttgcccacaagctgggattgcaatcagggtttgctttccatgacatatattcacta
acagacgcagatcttttagagtttttgccccgtccagtaaaggcaattatcttattgttt
cccttgaatgagttctttgagactcacaagcctcaatctcccaatcgtggggtccaaaag
gggggcgcagacaataccatttggttcaagcaaaatattaagaatgcatgtggattatat
gctatattacactctctttccaataacaaaagtttgctggaggatgattccacgctatcg
aagtttttgcaaacatatgataagaagaatgtggatgccacggatgaattcatctataat
gtgagcgagaccttttctgataattttgaagcaggtcaaacgtctgctccagaccctaac
gatgatgtaaatttacattttatcacgtttgttgccgatcctgagagtaaagatgtttat
gaattggatggtagaaatgaaaatggtccgatctttattggaaaattggatgaaagtgta
gataatggagatttaattggacagaaagatttgattgccagagtacaatggtatatgaac
aatgcatctgaagctgataaattaaatttttcgttactggggttatcctggaattag

DBGET integrated database retrieval system