KEGG   Naumovozyma castellii: NCAS_0H00910Help
Entry
NCAS_0H00910      CDS       T02233                                 

Gene name
NCAS0H00910
Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ncs  Naumovozyma castellii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ncs00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:169676..171616
Genome map
AA seq 646 aa AA seqDB search
MQLQLQDLILLATLSLQVGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDA
ITSEALESFLKRSTSNFSDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMD
NRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISH
SIINPGGWNILETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYT
WSTLRDADVFKNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVK
YLGTNVSNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLN
DLSADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERE
LDVIFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTF
FGCDARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNF
TDDSDFLGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAKDSTNATTSATG
SASIASASSTSSSSTNKKNAGVALNVNDSNIFMFMFSIISVVFSLI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacaacttcaagacctgatattgttggcaacgctttctctacaagtcggagct
tggtctccttccaacagctacgttccagcaaatgttacatgtgacgacaacataaattta
attagagaggccaattctctatccgatgacgagaaatcatggcttaccaagagagatgct
attaccagtgaggctctcgaatcttttttgaaacgttctactagtaatttctcagataca
tcactgatttctcaattattcagtgggaacagttcatcagctccaagaattggtgtcgca
tgttctggtggtgggtaccgtgcgatgttaagtggtgctggtatggttgctgccatggat
aacagaaccgatggtgccaatgaacatgggttaggtggtctattacagggtgcaacctac
ttagctgggctttctggggggaattggttgacaagtactttaggttggaataattggaca
tccgtgcaagccattttaaataatatgaccaatgatgattccatatgggatatttcacat
tcaattatcaacccaggtggttggaatatccttgagactggggaaagatgggatcacatc
tcagatgctgttcaagccaagcaggatgcaggattcaacatctctttggctgatgtttgg
ggacgtgcattatcttataattttttcccaagtctttatcgtggtggtcaaggttacact
tggtctactttgagagatgctgacgtatttaagaacgctgaaatgccattcccaatctcc
gttgctgatggtagatatcctggtactactgtgattaatttaaatgctaccgtttttgaa
tttaatccgtttgaaatgggttcatgggatccaactctaaatactttcactgacgtaaaa
tatttaggtactaacgtgtctaatgggaaaccaattactgaaggtaaatgtattgccggg
tttgataacactgggtttattactggtacctcatccactttatttaaccaatttttatta
cacattaactccacaagtttaccaagctttattactaaattagcatctcacttcctaaat
gatttatcagcagattataatgatattgccatctactctccaaatccatttagagatgct
gattttatcgctagtaattattctaagagtattgttcaatccaaggatttgttcttagtt
gatggtggtgaagataaccaaaatattccattggtgccattattacaaaaggaacgtgaa
ttggatgtcatctttgctctagataattccgctgatacaaaccaatcatggccagatggt
gcatccttggttaacacatacgaacgtcaattcggtatgcaaggtaacggtatggcattc
ccatatgtcccagacaagaatacgttcgttaacttaggattaaacaaaagaccaactttc
tttggttgtgatgctcgtaacttaactgatttggaatatattccacctttagttgtctat
attccaaatgctagacattcgttcaatggtaatcaaagtacctttaagatgtcatactca
acttctgaacgtttcagtatgatccaaaatgggtttgaatctgcaacaagaggtaatttt
actgatgactctgatttcttaggttgtattggttgtgccatcatgagacgtaagcaacaa
agtatgaatgctactttaccaactgaatgtaatcaatgtttcacgaattactgttggaat
ggtacgattgataacactccagcaaaagacagtacaaatgctaccacatctgccaccggt
tctgctagtatcgcatctgcaagttcaacgtcttcatcttctactaacaagaagaatgcc
ggtgtcgcattgaacgttaatgattcaaacatttttatgtttatgttttctattattagc
gttgtcttctctttgatttga

DBGET integrated database retrieval system