KEGG   Naumovozyma castellii: NCAS_0H02070Help
Entry
NCAS_0H02070      CDS       T02233                                 

Gene name
NCAS0H02070
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(join(403286..403653,403777..403789))
Genome map
AA seq 126 aa AA seqDB search
MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG
LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY
LISVKY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcgtgcactgataatttactagctaccggtaaagttgatagagctgtt
ctttactctagagcaggtgattctgtatgggccacttccggtggtttacaattacaacca
aatgagattgccgaaatcgctcgaggcttcgacaacccagctggattgcaaagcaatggt
ttgcatgtccaaggtcagaaatttatgttattgagagccgatgacaaaagtatttatggt
agacatgatgcagaaggtattgtctgtgttagaactttacaaacaatattgattgcgcat
tacccaccttctgtccaggctggggaggctaccaagattgtcgaacaattagcagattat
ttgattagtgttaagtactga

DBGET integrated database retrieval system