KEGG   Naumovozyma castellii: NCAS_0H02070Help
Entry
NCAS_0H02070      CDS       T02233                                 

Gene name
NCAS0H02070
Definition
(RefSeq) hypothetical protein
  KO
K05759  
profilin
Organism
ncs  Naumovozyma castellii
Brite
Membrane trafficking [BR:ncs04131]
 Others
  Actin-binding proteins
   Others
    NCAS_0H02070 (NCAS0H02070)
Cytoskeleton proteins [BR:ncs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     NCAS_0H02070 (NCAS0H02070)
Exosome [BR:ncs04147]
 Exosomal proteins
  Proteins found in most exosomes
   NCAS_0H02070 (NCAS0H02070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(join(403286..403653,403777..403789))
Genome map
AA seq 126 aa AA seqDB search
MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG
LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY
LISVKY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcgtgcactgataatttactagctaccggtaaagttgatagagctgtt
ctttactctagagcaggtgattctgtatgggccacttccggtggtttacaattacaacca
aatgagattgccgaaatcgctcgaggcttcgacaacccagctggattgcaaagcaatggt
ttgcatgtccaaggtcagaaatttatgttattgagagccgatgacaaaagtatttatggt
agacatgatgcagaaggtattgtctgtgttagaactttacaaacaatattgattgcgcat
tacccaccttctgtccaggctggggaggctaccaagattgtcgaacaattagcagattat
ttgattagtgttaagtactga

DBGET integrated database retrieval system