KEGG   Naumovozyma castellii: NCAS_0I00240Help
Entry
NCAS_0I00240      CDS       T02233                                 

Gene name
NCAS0I00240
Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ncs  Naumovozyma castellii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NCAS_0I00240 (NCAS0I00240)
Translation factors [BR:ncs03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NCAS_0I00240 (NCAS0I00240)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(28632..30914)
Genome map
AA seq 760 aa AA seqDB search
MNEEMFAGHYLKRLRHFPKDKTINERYPNMSASDVTTIKMEDIPVDDIDFSDLEKEYSID
DEFSFDQYVVVSGAPVIPESKVPVLQKALTGLFSKAGKVVNMDFPIDEASGKSKGFLFVE
CGSSDDAKKILKSFNGKRLDLKHRLFIYTMKDVEKFNSDHFEKEFKEPELPEFVSSGSLK
SWLLDDAGRDQFVIQRENLTTVAWNSMFHGSEEVETRDNWSTNYVRFSPKGTYLFSYHLQ
GVTAWGGAHFDRLRRFYHPNVRTSSVSPNEKYLVTFSADPIVIDEEDPESPFSKKNEGHQ
LCIWEISSGLLLATFPVIKSPYLQWPFVRWSYNDRYCARMVGDTLVVHDSEKNFAPLENK
SLKVPGIRDFSFAPTGVKLQPFRAGDEPSVLLSYWTPETNNISCKATIVEVPRGRVLKTV
NLVQVSNVTLHWQNQSEFLCFNVERHSKTGKTIFSNLELCRLTERDIPVEKVEMKDRVIA
FEWEPHGNRFITIAEQDTGDDNIAIPRNVIGFFAPEQRENVKDTSIKRWKLFKEIKGKFC
NTISWSPAGRFVVVATLVKPNVRKSTLDFFDMDYAGEKNMNDIQEVTASLKDVAQPANGA
ATDMTWDPSGRFVTVWSSALKHKVENGFRMYNVAGELVKEDFMPNFRNFAWRPRPESTLT
NAEKKKVRKNLREWSVQFEEQDAMDADTALRDAILKQRKALKEWTAYRVTTSSKLEKNFG
FKAYDTVNDEDDDDYVDVEELKEEIVEEKRKKFNCRFSYS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaatgtttgcaggccactacttaaaaaggttaagacactttcccaaggac
aagactattaacgaaaggtatccaaatatgtctgcctctgatgttactaccataaagatg
gaagatatcccagtggatgatatcgatttttcggatctagaaaaggaatacagtattgat
gatgaattttcttttgaccaatatgttgttgttagtggtgcaccagtgatcccagaatct
aaggttccagtcttacaaaaggctttgactgggttattctctaaggcaggtaaagttgtc
aatatggacttcccaattgacgaagcttctggtaagagtaaaggtttcttattcgtggaa
tgtggttcttctgatgatgctaagaaaatcttaaaatcctttaatggtaagagattggat
ttgaaacatcgtttgtttatttacactatgaaggatgtcgaaaaattcaattctgatcac
tttgaaaaagaattcaaagaacctgaacttcctgaatttgtttcatctggatctttgaaa
tcttggttattggatgatgccggaagagatcaatttgttattcaaagagaaaatttaact
actgttgcctggaattctatgttccatggttctgaagaagtggaaactagagacaattgg
tccaccaattatgtaagattctctccaaagggtacttatttgttttcttatcatttgcaa
ggtgttaccgcttggggtggagctcattttgatagattaagaagattttaccatccaaat
gttagaacttcttcagtgtcaccaaatgaaaaatacttggtcacattttctgctgatcca
attgttattgacgaagaagatccagaatctccattttctaaaaagaatgaaggtcatcaa
ctatgtatttgggaaatctcatctggtttgttattagccactttccctgtcattaaatca
ccatacttacaatggccatttgtcagatggtcatacaatgatagatattgtgctcgtatg
gttggtgatactttggtggttcatgattctgaaaagaattttgcaccattggaaaataag
agtttgaaggttccaggcattagagatttctcctttgcaccaaccggtgttaaattgcaa
cctttcagagctggcgatgaaccgtctgtattgttatcttactggactccagaaaccaat
aatatctcctgtaaagcaaccatcgtggaagtcccacgtggtagagtgctaaagacagtt
aatttggtccaagtttctaatgttactttacattggcaaaatcaatctgagttcctatgt
ttcaatgttgaaagacattccaagactggtaagacaatatttagtaatttggaactttgt
agattgactgaaagagatattcctgtggaaaaggttgaaatgaaagatcgtgttattgca
tttgaatgggaaccacatggaaacagatttattactattgctgaacaagatactggtgat
gataatattgctattccaagaaatgttattggattctttgcccctgaacaaagagaaaat
gttaaggatactagtattaaaagatggaaattatttaaggaaattaaggggaaattctgt
aatacaatttcttggtctccagctggtagatttgtggtggtagctacattagtgaaacca
aatgttcgtaaatctactttagatttctttgatatggattatgctggtgaaaagaatatg
aatgatattcaagaagttactgcatctttgaaggatgtggcacaaccagctaatggtgct
gctactgatatgacatgggatccatccggtagatttgttactgtttggtccagtgctttg
aaacataaagtggagaatgggtttagaatgtataatgttgctggtgaattagttaaagaa
gatttcatgccaaatttcagaaactttgcatggagaccaagacctgaatctaccttgacc
aatgctgaaaagaagaaggttagaaagaatctaagagaatggtcagttcaatttgaagaa
caagatgctatggatgctgatacagctctcagagatgccattttgaaacaacgtaaggca
ttgaaggaatggacagcttacagagtaactacatctagcaaattggagaaaaacttcggt
ttcaaagcttatgatactgtaaatgatgaagatgatgatgattacgttgatgttgaagaa
ttaaaggaggaaattgtggaggaaaaaaggaaaaagtttaattgtaggttctcatatagt
taa

DBGET integrated database retrieval system